SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080532 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080532
Domain Number 1 Region: 134-207
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000422
Family PHD domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080532   Gene: FBgn0032635   Transcript: FBtr0080979
Sequence length 404
Comment pep:known chromosome:BDGP5:2L:17410641:17413499:1 gene:FBgn0032635 transcript:FBtr0080979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESNATDGVHEVEESNPLEQSTITMLDVLEQEKELEDEYAAVLGASDEKSCTYAKGPIG
RQALYSCLTCCPEAREDLDKAAGVCLACSYRCHEHHELVELYTKRNFRCDCPTQRLGKCS
LNPQVEGVQPRNVGNLYNQNFQGLYCKCKRPYPDPDRTVEEVMLQCAICEDWFHLPHMKA
PGASDKWLDVCSEMICDGCMDAKPFLKDYTGLALQPVLEDAKEDKPEADDSQLKNELDRS
ICDIMKVPEGESQPDEGEPSQKRAKLDDCRRPKPTKEHQGAAFWTNDWRKSLCQCSECLS
LYKELAVEFLLDVEDSAKTYEERGMKRAEENSSYEQGIRALASIDRTQQIDAITEYNRMK
DKLKEYLQAFAASKKVVTEEDINRFFAGMRNENNANLGQPYFCR
Download sequence
Identical sequences Q9VJE3
FBpp0080532 FBpp0080532 7227.FBpp0080532 NP_609837.1.81976 FBpp0080532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]