SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0080535 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080535
Domain Number 1 Region: 115-235
Classification Level Classification E-value
Superfamily TPR-like 5.14e-33
Family Tetratricopeptide repeat (TPR) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080535   Gene: FBgn0032640   Transcript: FBtr0080982
Sequence length 331
Comment pep:known chromosome:BDGP5:2L:17473490:17474773:1 gene:FBgn0032640 transcript:FBtr0080982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDAVQQSFVRSFIDYLKKQGDVMSPDQTESIEVAIQCLQAAFDLGDDVEAAPAAAGEEQ
ATTQSSSTASAPDDDAVASGSAGIGAAAAAVPNNIDMFELFQSLYTERNPESLALAESIK
NEGNRLMKENKYNEALLQYNRAIAFDPKNPIFYCNRAAAHIRLGENERAVTDCKSALVYN
NNYSKAYCRLGVAYSNMGNFEKAEQAYAKAIELEPDNEVYKSNLEAARNARNQPPQTGRL
REDLINMLSQPMVRNLFNNAEIDVEQLLSMLQNPMIMNTIRQQFGGGNAPTLPNDMVQMI
YNMTSQLTGFPNSNANPGNEQQPGNQPPPST
Download sequence
Identical sequences Q9VJD4
FBpp0080535 NP_001246058.1.81976 NP_609842.1.81976 FR694 FBpp0080535 FBpp0080535 FBpp0296963 7227.FBpp0080535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]