SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080810 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080810
Domain Number 1 Region: 82-132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000454
Family EGF-type module 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080810   Gene: FBgn0005672   Transcript: FBtr0081269
Sequence length 234
Comment pep:known chromosome:BDGP5:2L:19567900:19572610:-1 gene:FBgn0005672 transcript:FBtr0081269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSTMSVQHGLVALVLIGCLAHPWHVEACSSRTVPKPRSSISSSMSGTALPPTQAPVTSS
TTMRTTTTTTPRPNITFPTYKCPETFDAWYCLNDAHCFAVKIADLPVYSCECAIGFMGQR
CEYKEIDNTYLPKRPRPMLEKASIASGAMCALVFMLFVCLAFYLRFEQRAAKKAYELEQE
LQQEYDDDDGQCECCRNRCCPDGQEPVILERKLPYHMRLEHALMSFAIRRSNKL
Download sequence
Identical sequences A4V0W1 Q01083
NP_001027281.1.81976 NP_476909.2.81976 NP_599118.2.81976 NP_599119.2.81976 NP_599120.2.81976 FBpp0080808 FBpp0080809 FBpp0080810 FBpp0080811 FBpp0100054 FBpp0080808 FBpp0080809 FBpp0080810 FBpp0080811 FBpp0080812 FBpp0080813 FBpp0100054 FBpp0080808 7227.FBpp0080809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]