SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082488 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082488
Domain Number 1 Region: 60-256
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-35
Family SPRY domain 0.013
Further Details:      
 
Domain Number 2 Region: 1260-1309
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000326
Family RING finger domain, C3HC4 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082488   Gene: FBgn0038296   Transcript: FBtr0083029
Sequence length 1332
Comment pep:known chromosome:BDGP5:3R:11016780:11021932:-1 gene:FBgn0038296 transcript:FBtr0083029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSISKLFVKVFNEDIFEQVDHDNLYSDLDDDLEGANCSTVPDPRPAKLADLSVTKQMLIV
RTWLDDKFQQIQTDSNEEIRRLYMETESRIGPDLTIFDVDYTTTVRVSSDRLALRSQGSF
NTVRANCCVYGGRWMYEIHLHTKGVMQIGWASNSCQFNENSGVGDTKSSYGYDGSKQQIW
HISTKKYGDKWQIGDVIGVTIDVDKEVIEYYRNGRSMGVAFNKLEKGPGISFFAAISLGY
TQGIEANFGNRPFMYPVSGFQPLMARPILKLQRANLLMNYLVNLAGIFSKYNAQSGMAPT
NGADARVSTKKTVYCIFATLLIEKFTNEIFDPYIIEDVLLRKISSMTNLASEKENSYSVL
HGLLSLFWNYMEGDEIKFVLRKLVNALLGTFTHTIQGLDYEKHRQALGMLHCLCLHEQTR
KYLLEGKLFKKHCLAFFLYIHPLEFYIMEELLPDSMAWTEGIDGPKEKYLNVVEKVRKVT
EPLYTAQKDLLCTLMINSDGSRESPSSRSIFLSKLRRYVIDLSMEQRPFHAFFFMQSSIQ
HPLDAPVALAFASILIDQTRSMFKDEMPTKNVEVNSDYFIDGTFDYMHFDRVGGVLSHLR
KVHRGDIDARLGSARTQQIYEDDRQNLRVNEVDTTLYLLGENINNVPVVGHTQGANNTTY
THFLNTRPNSSTDSSPGNADMEASLCELLDLCIIFYYSAGHKYIVKIATVRDEIAALNEV
LKETKFYREDIERKLGALEQHANVCMNENHQHVMGELRSKFSQRQNVFATRSIALARKQV
WLRGVALNNHRRSLLIWLLERMLRTLTTASNTGSLFSFVPEVYVNTLPILLDAVMDFSHH
DLKAQFEASDAECSVNAAAEFLGIHSADPRIVLASCKDSLLQALGTLTCHKSGVRALERT
SKRSQASLVRALLRPYENRAWGQSNWLLLRFWMGEGYAYKDSRQPSVWQGGSLPLHQGLC
RSRSRNETHTGLLHNVAPANPSKHFQRLIGAKLLEDEPFATAFLNSVLSQLNWAFSEFIL
LLQEIQNTAQRQENTLFEPKQLKICSMCFELTVSLMRCLEMVITTAPEIVTDESRPNSDL
LLNRICQLISQVLSRVTVPPGCFQFVVDMCSADLNAVTHYPIVTAALGILLALMQEEMES
DLRPQIVTRVSRAFLTDPSFQFATLEFALGEIRTPLLEQKNIPRGNFDPSSRPHIDPLTN
DVRVPLPNNSKRIRADPPILKFALNDFPSHVSSEEIDNVRRLIDSLRVKQTLLSDITLPS
EDSLCPICCAKPITAVFTPCKHQSCSDCIMQHMMNSKVCFYCKTTIQTIETLDGTVIFSN
DDVVQTPMIERA
Download sequence
Identical sequences Q9VFC4
7227.FBpp0082488 NP_001247116.1.81976 NP_650425.1.81976 FBpp0082488 FBpp0297356 FBpp0082488 FBpp0082488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]