SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082591 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082591
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 2.75e-23
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0000114
Further Details:      
 
Domain Number 2 Region: 78-169
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.58e-19
Family Cold shock DNA-binding domain-like 0.0000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082591   Gene: FBgn0051155   Transcript: FBtr0083137
Sequence length 173
Comment pep:known chromosome:BDGP5:3R:11047971:11048849:-1 gene:FBgn0051155 transcript:FBtr0083137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYHISLEQEILLHPRYFGPQLLETVKQKLYSEVEGTCTGKYGFVIAVTTIDQIGSGVIQ
PGQGFVVYPVKYKAIVFRPFKGEVLDAVVKQINKVGMFAEIGPLSCFISHHSIPADMQFC
PNGNPPCYKSKDEDVVISGEDKIRLKIVGTRVDATGIFAIGTLMDDYLGLVSN
Download sequence
Identical sequences B4HE07 B4QZ40 Q9VFB5
NP_731983.1.81976 XP_002031113.1.34323 XP_002103365.1.80810 7227.FBpp0082591 FBpp0082591 FBpp0207274 FBpp0082591 FBpp0082591 FBpp0218776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]