SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082735 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082735
Domain Number 1 Region: 124-166
Classification Level Classification E-value
Superfamily SAP domain 0.000000000000307
Family SAP domain 0.0056
Further Details:      
 
Weak hits

Sequence:  FBpp0082735
Domain Number - Region: 27-106
Classification Level Classification E-value
Superfamily Saposin 0.01
Family NKL-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082735   Gene: FBgn0027095   Transcript: FBtr0083283
Sequence length 173
Comment pep:known chromosome:BDGP5:3R:12175126:12176523:1 gene:FBgn0027095 transcript:FBtr0083283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTWYMVVVIGFLATLAQTSLALKEEDCEVCVKTVRRFADSLDDSTKKDYKQIETAFKKF
CKAQKNKEHRFCYYLGGLEESATGILNELSKPLSWSMPAEKICEKLKKKDAQICDLRYEK
QIDLNSVDLKKLKVRDLKKILNDWDESCDGCLEKGDFIKRIEELKPKYSRSEL
Download sequence
Identical sequences Q9XZ63
7227.FBpp0082735 FBpp0082735 NP_477445.1.81976 FBpp0082735 FBpp0082735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]