SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083177 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083177
Domain Number 1 Region: 64-102
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000458
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083177   Gene: FBgn0051221   Transcript: FBtr0083763
Sequence length 219
Comment pep:known chromosome:BDGP5:3R:15238416:15286033:1 gene:FBgn0051221 transcript:FBtr0083763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFLAMDHHHHHHHQQPRQHHLSMWPSFAVCLLLLQTTTTTMAIDLSRLYGHMANPIVKR
SEACHPYEPFKCPGDGNCISIQYLCDGAPDCSDGYDEDMRLCTAAKRPPVEETASFLQSL
IASHGPNYLEKLFGSKARDALSPLGGVEKVAIALSESQTIEDFGAALHLMRSDLEHLRSV
FMAVENGDLGMLKSLGIKDSELGDVKFFLEKLVNTGFLD
Download sequence
Identical sequences Q7JRL9
FBpp0083176 FBpp0083177 NP_732424.1.81976 NP_732425.1.81976 7227.FBpp0083176 FBpp0083176 FBpp0083176 FBpp0083177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]