SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083244 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083244
Domain Number 1 Region: 261-312
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000571
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 2 Region: 191-225
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000157
Family CCCH zinc finger 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083244   Gene: FBgn0038772   Transcript: FBtr0083835
Sequence length 357
Comment pep:known chromosome:BDGP5:3R:15883472:15885013:1 gene:FBgn0038772 transcript:FBtr0083835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEEAASTSSFGFKKRNLKKGAGIRRKKETSSDESAKSSDEETKGKASALVRAENRRKRT
NPNFQSTKTMSKAKRQAGGVGDDGSSSASDDDKLGIAYKSKREALPSGPQDQGATSINEM
DTELDRDAQAIHARALKINEELEGKADDKIYRGINNYAQYYKKQDTAAGNASSGMVRSGP
IRAPAHLRATVRWDYQPDICKDYKETGYCGFGDSCKFLHDRSDYKAGWQLEMDHENQRTG
DVDSDGDDTKYEIHSDEETLPFKCHICRQSFVNPVVTKCKHYFCEKCALAQYKKSQRCII
CSQQTNGIFNPAKELIARLKTNPMENSDSDEEEEFGKKEDKAEAGEEAQEISSDDSD
Download sequence
Identical sequences Q9VDP8
7227.FBpp0083244 NP_650865.1.81976 FBpp0083244 FBpp0083244 FBpp0083244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]