SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083632 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083632
Domain Number 1 Region: 41-330
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.11e-60
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083632   Gene: FBgn0038948   Transcript: FBtr0084239
Sequence length 408
Comment pep:known chromosome:BDGP5:3R:18186504:18188255:-1 gene:FBgn0038948 transcript:FBtr0084239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEEFKLPKRSRKRTREVKRKARPELDGENAWSAMRYCEKFEPFWDFTDNLERIEESQVP
ESEFIERFERPYKPVVIRGCTDGWLALEKWTLARLAKKYRNQKFKCGEDNEGYSVKMKMK
YYVEYMQSTRDDSPLYIFDSSFGEHHRRRKLLDDYVVPKYFRDDLFQYCGENRRPPYRWF
VMGPARSGTGIHIDPLGTSAWNTLIRGHKRWCLFPTQTPKELLKVTSAMGGKQRDEAITW
FSTIYPRTQLPSWPEQYRPIEVLQGAGETVFVPGGWWHVVLNMDDTIAITQNFSSQTNFP
CVWHKTVRGRPKLSRKWLRVLRDQRPELAQIADSINLNESTGFASDSSSNSSSSSSSSSS
SSEEEESDDGGDSNTDSGQESLTAKKKKKRRMAGGGSGSGSMGGSSRS
Download sequence
Identical sequences Q9VD28
FBpp0083632 FBpp0083632 7227.FBpp0083632 NP_651026.1.81976 FBpp0083632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]