SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085638 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085638
Domain Number 1 Region: 414-742
Classification Level Classification E-value
Superfamily L domain-like 5.78e-49
Family Internalin LRR domain 0.088
Further Details:      
 
Domain Number 2 Region: 108-455
Classification Level Classification E-value
Superfamily L domain-like 3.4e-47
Family Ngr ectodomain-like 0.016
Further Details:      
 
Domain Number 3 Region: 830-998
Classification Level Classification E-value
Superfamily L domain-like 1.02e-27
Family Ngr ectodomain-like 0.024
Further Details:      
 
Domain Number 4 Region: 1094-1234
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.49e-22
Family Toll/Interleukin receptor TIR domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085638   Gene: FBgn0034476   Transcript: FBtr0086336
Sequence length 1446
Comment pep:known chromosome:BDGP5:2R:15714410:15720473:1 gene:FBgn0034476 transcript:FBtr0086336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAILLLLLGFSWSLAVESALAPKESESSASAMLGAGTGAAATVSLSGDYSSLLSNVPAA
SPVPANPSQPSGPANQCSWSYNGTSSVHCALRLIERQPGLDLQGADGSSQLTIQCSELYL
FESTLPVAVFARLQTLEALRLDSCKLLQLPNNAFEGLATLKSLRLSTHNSEWGPTRTLEL
FPDSLGGLKQLTDLDLGDNNLRQLPSGFLCPVGNLQVLNLTRNRIRTAEQMGFADMNCGA
GSGSAGSELQVLDASHNELRSISESWGISRLRRLQHLNLAYNNLSELSGEALAGLASLRI
VNLSNNHLETLPEGLFAGSKELREIHLQQNELYELPKGLFHRLEQLLVVDLSGNQLTSNH
VDNTTFAGLIRLIVLNLAHNALTRIDYRTFKELYFLQILNLRNNSIGHIEDNAFLPLYNL
HTLNLAENRLHTLDDKLFNGLYVLSKLTLNNNLISVVEPAVFKNCSDLKELDLSSNQLNE
VPRALQDLAMLRTLDLGENQIRTFDNQSFKNLHQLTGLRLIDNQIGNITVGMFQDLPRLS
VLNLAKNRIQSIERGSFDKNFELEAIRLDRNFLADINGVFATLVSLLWLNLSENHLVWFD
YAFIPSNLKWLDIHGNYIEALGNYYKLQEEIRVKTLDASHNRITEIGPMSIPNTIELLFI
NNNLIGNVQPNAFVDKANLARVDLYANQLSKLQLQQLRVAPVVAPKPLPEFYLGGNPFEC
DCTMDWLQRINNLTTRQHPRVMDMANIECVMPHARGAAVRPLSGLRPQDFLCRYESHCFA
LCHCCDFDACDCEMTCPSNCTCYHDQIWSTNVVDCGGQQTTELPRRVPMDSSVVYLDGNN
FPVLKNHAFIGRKNLRALYVNGSQVAAIQNRTFASLASLQLLHLADNKLRTLHGYEFEQL
SALRELYLQNNQLTTIENATLAPLAALELIRIDGNRLVTLPIWQMHATHFGTRLKSISLG
RNQWSCRCQFLQALTSYVADNALIVQDAQDIYCMAASSGTGSAALEDSSSNSGSLEKREL
DFNATGAACTDYYSGGSMLQHGIPESYIPLLAAALALLFLLVVIAMVFAFRESLRIWLFA
HYGVRVFGPRCEESEKLYDAVLLHSAKDSEFVCQHLAAQLETGRPPLRVCLQHRDLAHDA
THYQLLEATRVSRRVVILLTRNFLQTEWARCELRRSVHDALRGRPQKLVIIEEPEVAFEA
ESDIELLPYLKTSAVHRIRRSDRHFWEKLRYALPVDYPTFRGNNYTLELDHHNHERVKQP
ASPGLLYRQAPPPAYCGPADAVGIGAVPQVVPVNASVPAEQNYSTATTATPSPRPQRRGE
QPGSGSGGNHHLHAQYYQHHGMRPPSEHIYSSIDSDYSTLDNEQHMLMMPGAPGGLAMEA
AQRAQTWRPKREQLHLQQAQAGTLGSKASQAAHQQQQQQQQQQQQQPNPTAVSGQQQGPH
VQAYLV
Download sequence
Identical sequences Q7KIN0
FBpp0085638 FBpp0085638 NP_523797.1.81976 7227.FBpp0085638 FBpp0085638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]