SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087114 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087114
Domain Number 1 Region: 65-146
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.9e-26
Family Cold shock DNA-binding domain-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087114   Gene: FBgn0033699   Transcript: FBtr0088006
Sequence length 154
Comment pep:known chromosome:BDGP5:2R:8086524:8088333:-1 gene:FBgn0033699 transcript:FBtr0088006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQQTERSFRKQHAVVVVRRKSPNLKKRPRFYRQIGLGFRAPAEAIDGTYIDKKCPWTG
DVRIRGRILTGVVRKAKMQRTIVIRRDYLHFVRKYSRFEKRHRNMSVHCSPVFRDVEHGD
IVTIGECRPLSKTVRFNVLKVSKGQGAKKSFKKY
Download sequence
Identical sequences A1Z8U9
FBpp0087114 FBpp0087114 NP_725115.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]