SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0088484 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088484
Domain Number 1 Region: 572-776
Classification Level Classification E-value
Superfamily NTF2-like 2.19e-33
Family NTF2-like 0.0064
Further Details:      
 
Domain Number 2 Region: 420-565
Classification Level Classification E-value
Superfamily L domain-like 4.76e-16
Family mRNA export factor tap 0.0069
Further Details:      
 
Domain Number 3 Region: 164-285
Classification Level Classification E-value
Superfamily L domain-like 0.0000000238
Family mRNA export factor tap 0.045
Further Details:      
 
Domain Number 4 Region: 792-840
Classification Level Classification E-value
Superfamily UBA-like 0.00000156
Family TAP-C domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088484   Gene: FBgn0036640   Transcript: FBtr0089479
Sequence length 841
Comment pep:known chromosome:BDGP5:3L:16569959:16573094:-1 gene:FBgn0036640 transcript:FBtr0089479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNQMRVLDFGDGSVPIQLDYPDSKIFSKCSSYGDRVPGTHWNEITVHHKGRLEYSPNPE
QIILDALYQAIDGADFFPVFYQRGKNMDTMLVRNCKAAIDKLFKQRLSINLKGGASIPIS
IQLGVAQYQRHQITPTFHIARVVTRLMKQLIQRDGVDGLLNLDNFGSHPEFKNLVVSLGN
PSILMNVCQVIHNDDNERFRLNGFILSNNRIRDIRPLTLLANVDYALLDLRGNKIKSAER
LCRALEQFRARELLLENNPIVKISNFPANIKSLESNFELVDGKPFNMLHKIFSPLDVEID
LEVDGARIDTNNMWKLPEFENSQHWHAFMIPDPSHEFNQEVFFDFFFIRLDPTLSNFYPC
YYKYINTEHVFLVRNCFDQIAHLVNNCNLEMTIPTGDRIFRYYLRMNVSTVKQHHVDPEE
CIQKAVSQCYVAQNRMLNLERFHSRECLKDVMVSLSSPKILTYVLSVASRKFMTTCSEIR
LCHNKVLVLDGAHVLGMMGCLRAVDLSHNWVQDLSSIHSLGNLPLKSLVLHGNKLCRNYR
LPSEYVRAVKEVFPQLTTLDGVDLQTNPGQSLQKNFLCDTGAYELVGAFLENYLREFEND
EFRHNLYKYYSENSIFTLTCNYNVVQNHQTPKILQRLSKYNRHARNLRNKDYSKASDGVF
FGCTYIVEILLQLPRVTHDFHSLQTDVMHYNGKGAVIYVAGLLRDEPPSTRNGHGSKTDI
GGVLLGFSRQFVVTFDEANLGLGKRARRLKIANERLHITNPSKTAIRNAFSVNFPDPSER
QAEEDSLDVKDHKLLLFQEVTGLISTWVTSIVEEADWDFERALKLFIQKNADHEIPDLAF
A
Download sequence
Identical sequences Q9VV73
FBpp0088483 FBpp0088484 7227.FBpp0088483 FBpp0088483 FBpp0088483 FBpp0088484 NP_524111.3.81976 NP_730179.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]