SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088516 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088516
Domain Number 1 Region: 30-110
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 7.46e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0033
Further Details:      
 
Weak hits

Sequence:  FBpp0088516
Domain Number - Region: 113-185
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00609
Family Family 6 carbohydrate binding module, CBM6 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088516   Gene: FBgn0022740   Transcript: FBtr0089547
Sequence length 242
Comment pep:known chromosome:BDGP5:2R:13644922:13648022:1 gene:FBgn0022740 transcript:FBtr0089547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRKKRSSSPTEFFDDDFDEDASSQSSQPPVQRNAANARERMRMRVLSSAYGRLKTKLPN
IPPDTKLSKLDTLRLATLYIKQLITAVETGSHSQNHPHNHNQHHSLNHSHSSTTSSEGLD
TSHMADSSGGGNYNFHNNGHGMSWPFEFHQSSRSLAFAPSSSTTSSARMDWQTLHTQSYP
KTTRGETHVSADLSYHQLPESHSHWYPAEVHQMEPAASCSYDSGMGQHQRGIAIATSHAH
GI
Download sequence
Identical sequences Q0IGU7
7227.FBpp0088516 NP_477302.1.81976 FBpp0088516 FBpp0088516 FBpp0088516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]