SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0099403 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0099403
Domain Number 1 Region: 280-382
Classification Level Classification E-value
Superfamily SH2 domain 3.77e-26
Family SH2 domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0099403   Gene: FBgn0053993   Transcript: FBtr0100046
Sequence length 421
Comment pep:known chromosome:BDGP5:3L:5926136:5943758:-1 gene:FBgn0053993 transcript:FBtr0100046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIMQDIRLRLEPQHSKATFISSSSASSSSSQTAETTLIETAEKSPASEAAAGTVTTTSPQ
HFFHHHHPPAHPHPPRQQPHPHSHSHPHPHPQLQRRPVEQLHLLHSHHDVQELSGQEHPH
PQPGSHPHPHHLRSPSSEEDNSPTEMNNCRRLVDKPPLVKRLTMGIGLLRGTEDSRPLMH
STCGSSLTSGSGCGSTQTISDGYVNEAICEPDKYVASKFGDSCRQSLSALESATQRLQVE
LPAASKKYLRETCSANSSPKLFPGHSALRLDNLSLAEQQELKGAAWFQAGIPREISLEAL
SRQSPGAFLVRQSSTKPGCFALSLRVPPPSPRVAHYLILRTQRGYKIKGFTKEFSSLKAL
ITHHSVMPELLPVPLTLPRPPSTRSQRSQGAYAGGTGNGGADFEMYGSLNDFRKMMADLN
V
Download sequence
Identical sequences Q6NR09
FBpp0290256 7227.FBpp0099403 FBpp0099403 FBpp0099403 NP_001033991.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]