SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0110259 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0110259
Domain Number 1 Region: 842-918
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000169
Family I set domains 0.024
Further Details:      
 
Domain Number 2 Region: 749-806
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000011
Family TSP-1 type 1 repeat 0.007
Further Details:      
 
Domain Number 3 Region: 687-746
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000301
Family TSP-1 type 1 repeat 0.0063
Further Details:      
 
Domain Number 4 Region: 543-600
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000353
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 5 Region: 75-123
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.00082
Further Details:      
 
Domain Number 6 Region: 306-370
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000353
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 7 Region: 365-422
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000484
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number 8 Region: 1288-1343
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000732
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 9 Region: 249-311
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000183
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 10 Region: 1149-1227
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000275
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 
Weak hits

Sequence:  FBpp0110259
Domain Number - Region: 626-684
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000484
Family TSP-1 type 1 repeat 0.011
Further Details:      
 
Domain Number - Region: 1224-1285
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00863
Family TSP-1 type 1 repeat 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0110259   Gene: FBgn0051619   Transcript: FBtr0110959
Sequence length 1394
Comment pep:known chromosome:BDGP5:2L:21684103:21729051:1 gene:FBgn0051619 transcript:FBtr0110959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVNMNWTSPKIWAALFVTTLCLLDTQAAWAKKLNASQAFDDTWNTASDLENELEQQKRS
KVQSAGGGGGAGGGPGQWSSWSDWSTCSRTCDGGIMHQMRRCGSPGSCRGESTRYRICNM
QPCPEQQDFRSSQCSAYNDVPYDGTLYKWTPHYDYVEPCALTCRGHPAHLVEDISRETGD
GNAEEAEHYDEQSVIVQLSARVQDGTRCRSGSLDMCIQGKCQRVGCDLKIGSTKKIDGCG
VCGGDGNSCSQPLFNWEMAPMSQCSVTCGSGYKMSRPICRNRLTNADVDDTLCSVTNRPE
ASVEQCNTHSCPPRWIADDWSTCSRLCGHGYRERMVVCAEESNGIKTRVADIMCRTPKPP
TQETCIIEECPHWEVEDWTGCSVSCGQGIQMRGVECKSTDGSLSAKCDPLTKPGSMQQCS
TGIHCGGSLNKVGGTIIVGSSRSLNERSERQLDSSDADEDNEDENDEGDDVDDLESGQDT
DDGEGLSYADQPLLYAHRTQSRLNQEAPDEPRTMHLMNGNSNNNFNRGEDESEGPSLDPT
YIKDNEWSPCSVTCGEGIRRRTYNCKIFLEYSRTVATVNDSLCEGKKPHDEVERCVEDPC
MLPSHGFDDQFPRDSIKVGVSEPGKTYVWREQGYTSCSASCLGGVEELIINCVREDNGRV
VSPFLCSPETKPEARVRTCNDRPCPPRWNYSDYTPCSKSCGIGIKTREVQCIHEVTRGGD
NTMVVPNSMCPQPPPADRQYCNVLDCPVRWEVGEWSKCSHTCGYGFKDRKVECKQIMAQE
HKIERPESMCPSAKPADKKPCNVKPCPPEDPKPVIQINNSTHIQHDPKKTKITLKVGGAG
LVFFGTQVKIKCPVKRYNRTKIKWSKDHKPLQRSRKYKVSKKGALRILDITFRDAGVYSC
HAGLSSAEISIEVKAKPGQQIEELEQQETERLVREKSGTEALTSADMKSADGTGTSTAVG
PNSHVNGSAQQHGSRRRQQQSERLQNGRERSRRPKSDGVQHADSSIMEDDLSQLVQSEDR
IPQPASASSGGSRTRTLLAMPYFQALLSNLQLLWPLQRFKDSRGQHLLQGEALKFGIDLS
GKDFDQDESERVPAEQLPPEVLHSPSDPEYHEPSKSGPEADVPHVPPHMPHARWETGAAA
STTAVPSLPNDGFVYRWMLGEWSQCSQECGAAGSGLQRRTVSCQRAAKATSSGSTSDTEN
NVVDNSECFAHGLELPEFFQSCGNEACPQWSKGDWTPCQRSHCHGRNTAMQRREVTCRYP
NGTEGSICDEYERPAMRQECYNERCEGVWRVEPWSECNAPCGRKGIKYRILQCVWYGSRR
PAGNVCKHQPRPAVMKVCKSPACQAQLSSSPAQLCRDSSRYCRNARAMGLCRLHRYKLKC
CGSCEQQPNQHLIL
Download sequence
Identical sequences Q0E8N3
FBpp0085256 FBpp0110259 NP_001036374.1.81976 NP_001246128.1.81976 7227.FBpp0110259 FBpp0110259 FBpp0298832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]