SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0288683 from Drosophila melanogaster 76_5

(show help)
Strong hits

Sequence:	FBpp0288683
Domain Number 1	Region: 230-380
Classification Level	Classification	E-value
Superfamily	TRAF domain-like	3.27e-41
Family	MATH domain	0.000018
Further Details:

Domain Number 2	Region: 4-68
Classification Level	Classification	E-value
Superfamily	TRAF domain-like	0.000000000245
Family	SIAH, seven in absentia homolog	0.038
Further Details:

Domain Number 3	Region: 154-197
Classification Level	Classification	E-value
Superfamily	TRAF domain-like	0.000000517
Family	SIAH, seven in absentia homolog	0.011
Further Details:

Domain Number 4	Region: 118-169
Classification Level	Classification	E-value
Superfamily	TRAF domain-like	0.00000654
Family	SIAH, seven in absentia homolog	0.019
Further Details:

Weak hits

Sequence:	FBpp0288683
Domain Number -	Region: 64-117
Classification Level	Classification	E-value
Superfamily	TRAF domain-like	0.0017
Family	SIAH, seven in absentia homolog	0.016
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

External link(s)	Protein: FBpp0288683 Gene: FBgn0026319 Transcript: FBtr0290244
Sequence length	387
Comment	pep:known chromosome:BDGP5:2L:4378540:4380725:1 gene:FBgn0026319 transcript:FBtr0290244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MGSLVFCIHHKQGCKWSDELRKLKGHLNACKHDATQCPNKCGAQIPRIMMTDHLQYTCTM RRTRCEFCQSEFSGAGLEEHNGSCGQEPVYCEAKCGQRILRGRMTLHKSKDCAKRLRRCA HCQREFSADTLPLHAAQCPRAPLACPQRCDAGPIPRGELEAHLRDECQSLAVSCSFKEAG CRFKGPRQMLEAHLESNAAAHLSLMVALSSRQGQQIQMLKSAVSKLSINYTGTLLWKITD WSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDA LLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHE LLHSRPFIKGDTVFLRVKVDPSKIVAV
Download sequence
Identical sequences	FBpp0288683 FBpp0288683

SEARCH