SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289140 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289140
Domain Number 1 Region: 83-130
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000209
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 2 Region: 55-80
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000693
Family Somatomedin B domain 0.0044
Further Details:      
 
Weak hits

Sequence:  FBpp0289140
Domain Number - Region: 299-329
Classification Level Classification E-value
Superfamily EspA/CesA-like 0.0785
Family EspA-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289140   Gene: FBgn0259241   Transcript: FBtr0299862
Sequence length 395
Comment pep:known chromosome:BDGP5:X:10861755:10933934:-1 gene:FBgn0259241 transcript:FBtr0299862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLLLLLAVILPQRQLLPFVSGGSCREAQLCCNGRDSSCVVQKAPINAIIEDLSDKPCY
CDHACLKLGDCCDDFKDHCGVLDCQVGDWGAWSECDRSCGTGMMTRNRQILQAAQNGGKH
CPTLQQKRSCQGYRCHGHHDKKILREMALLLPAALTHNHHVNESGDLRHNLRTRYRDTYK
HNHDQEYCVEFEVIKSSKACNKLPPYNLMTEGDRITVRCDLEALIQDSAGSSTTARTPQG
PTTPSTTTVSSAASAFGQRTDDLEEERLQRETSSEEEATNQDGEAEEEDEEPEQDEQDDL
QNALDSDSNESTDYRHQRQSQMSQMSHSRRTAGKRSAVPATPSPTLPPTYHCRGEGLAGR
TTRWSALPAPSCRGKWLRLTVGPPKKCGHAQFIFV
Download sequence
Identical sequences Q9VZ43
FBpp0289140 FBpp0289140 NP_572674.3.81976 7227.FBpp0289140 FBpp0289140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]