SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289440 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289440
Domain Number 1 Region: 1248-1514
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 8.89e-16
Family Soluble quinoprotein glucose dehydrogenase 0.017
Further Details:      
 
Domain Number 2 Region: 659-684
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000345
Family EGF-type module 0.05
Further Details:      
 
Weak hits

Sequence:  FBpp0289440
Domain Number - Region: 910-979
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000365
Family Pre-dockerin domain 0.075
Further Details:      
 
Domain Number - Region: 730-753
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000502
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Domain Number - Region: 629-653
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000639
Family Integrin beta EGF-like domains 0.091
Further Details:      
 
Domain Number - Region: 760-785
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00157
Family Integrin beta EGF-like domains 0.067
Further Details:      
 
Domain Number - Region: 265-405
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00366
Family beta-sandwich domain of Sec23/24 0.024
Further Details:      
 
Domain Number - Region: 788-824
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00953
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 564-588
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0199
Family EGF-type module 0.087
Further Details:      
 
Domain Number - Region: 593-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0366
Family Integrin beta EGF-like domains 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289440   Gene: FBgn0259240   Transcript: FBtr0300203
Sequence length 3004
Comment pep:known chromosome:BDGP5:X:12089802:12226198:1 gene:FBgn0259240 transcript:FBtr0300203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMKSMKYSDCDTIMDGYNPVPPPLPRRVPPVRNIYAEPFAHEPNHSSRLGGHPQQMPQS
MSTGSNTIGHGGIDRGGVGLPMGAGTMPGGVGGGPGGVAGGGPQVGVGPPGSGNGGNCQI
SGSQPLVMPGFPLRNSHSAHAPHYSPYSPSRFHIDKRCQHRCSWKCLSIALIFVSVVLTA
MLAYFAAVSSMKPNMDSTNCILVQDVKSQPHDLRGGLAKSNEKGVATAFPTEESIQTSTS
DHGQNGHGLMNPSAGSGGSNSGIQQQLLLQQQQPHSINQPLTPLDATNTHLQDHHQLTYG
GALPGGVGGIGMSGGGIMNGGLNGGLGGQLMQQPGGGLNGHHHQALQPQLGGVVELKEFN
EAYHATIPAYQFWTLEFRNKHPAFIRFNFTLPWGAHFAVYSRRNVAPSVTQHDFVEFIKG
GRLDSHLRHRRSSANATTTGQDMELYRQDKDQSAESAQDQDSEQDESRSFDSSESYDVET
PLDTAKQHLQRIGKPQSHWVNKRSAGDGLPALDVDAMTVNVSLLQYLDTGLWFISVYNDE
LVAHSVSLLAEEAEGVSTTCPNDCSGRGSCYLGKCDCIDGYQGVDCSKSVCPVLCSAHGH
YGGGVCHCEEGWKGAECDIPVGECEVPNCSSHGRCIEGECHCERGWKGPYCDQHDCLDPL
CSGHGTCVAGQCYCKAGWQGEDCGTIDQQVYQCLPGCSEHGTYDLETGQCVCERHWTGPD
CSQAVCSLDCGRNGVCESGKCRCNSGWTGNLCDQLPCDSRCSEHGQCKNGTCVCSQGWNG
RHCTLPGCENGCSRHGQCTLENGEYRCDCIEGWAGRDCSIALELNCKDNIDNDGDGMTDC
SDSECCSHPACSEHIMCLSSNDPVEVLLRKQPPSVTASFYQRVKFLIEENSVQSYAHMDE
YSENRVSVMRGQVITPQGLGIVGIRVSVDRDSRFGFTLTRQGGWFDVLVNGGGAVTLQFQ
RSPFRPLTRTVFVPWNRIVVLPPVQMQLSDDDETTSRNIKVAPLNPALTFLNSIHYHTAD
EANDASKVCMDHDHEKLRPQLISTWMPNGVGAMPGKRVIFAETQIVQESIQIPGSDLHLT
YQSSQASGYLSIVRMRLTGETIPPTLTHVHVGVEIEGALHVKTYEADPSLVHTFAWNKRN
VYRQKVYGVTVARISVGYQHSTCQSPVWIAQTAKLQGYDVDISDIGGWGLDIHHHYNFHE
GILQKGDGSTLHMKEYPRTVKVVMGTGLQRPLTCPDYCNGVAKDAKLLTPIALATGPDGS
LYVGDFNLVRRITPDGKVYTILQLSATQVSYQYYLAVSPADGHLYISDPERHQILRLVRL
EKVKDPSINSDPVVGSGQRCIPGDEGNCGDGGPALLARLSHPKGLAIAADRTMYIADGTN
IRAVDPKGVIHTLIGHHGHHNHWSPAPCSGTLMANQAQLQWPTGLALSPLDGSLHFIDDR
LVLRLTSDMKIRVVAGTPLHCSNGGQDGRVNKTGADNVLGTVLAMAFSPFGNLYIADSDS
RRVNSIRVVDTAGNMRYFAGKQEGTGSQTCDCAIGGGSNGSATNSGVGGAGGSAYSTTVN
PTRPNGGTTPTTPSGGNGNGNGNGSSATSSGGSVGGSNGSGGGANGGACICAGGIALSTG
TGSSSGSNGGGTLASIVGSGGLMSTGPTTTTTVLLGAKTTAAGIGAATLNDDGTLSNAET
LLSSNARFQAISAIAVAQDGVINVADQGSLHVLALEHYLPSHDENGEFHIPFPPSSEIYV
FNRYGQHVATKDLTSGKTRYSFLYSKNTSFGRLSTVTDASGNKIQFLRDYSNVVSSIENT
QDHKSEIQINGIGIMTKLSEKGRQEIELDYDSNTGLLNSRSSGGETYIYQYDEFGRVTGM
ILPSGEIVRITSQLADSQGLTVYVHASVESLFSRERIAGEANELLVLGGVRSTFLKRGQA
HADAELKANNTLVIHGDNGVVVEASAVARHPLLEAALPVEAEMLAMWSHQSVTMGEGLTN
SMYSVYSLVGDVRNPQQTLNREIWVNQSRVIGVEFDQFTNRETFYDARRTPILIVAYDQS
GLPKSYYPTNGYPVNITYDRFNRVEGWAWGPAELKYSYDRHGLLSEITSQQDGIVSFVYN
DWNLVSEIGLASQRKFVLQYDDAGGLRHVVLPSGTRHSFSMQTSIGFIRCTYTPPGSTRA
YLQHYSHAGALLQTILPGDGARIVYRYNAAGQLTEVVHGDGRSEFQYNEATGMPSTVSHT
ERELEYRWDFEYAAGLLAEERIDYVAKTGLSNAKFSYEYDSQLRVVALQGRIGGQSLPTQ
AFAYDPRTGRPSLIGQFRFSQPAQNQTQLHDGTASFTRTVDGRFQTQRMALAIHRLEVFR
MEFSYGVHGRISQTRTYTRNMAVNSYTNVKNYTWDCDGQLVGVEAQEPWGFRYDDNGNLL
SLTYRGNTIPMEYNAQDRIVKFGEGQYKYDARGLVAQNAREERFHYNTQGLLVRASKRGR
FDVRYYYDHLKRLTTRKDNFGNVTQFFYTNQQRPYEVSQIYSPRDGKLMSLTYDDVGHLI
YAQVYRHKYYVATDQSGTPLMLFNQYGEGIREIMRSPFGHIVYDSNPYLYLPIDFCGGIL
DQVTTLVHMGDGRVYDPLIGQWMSPDWQRVAERIITPTRLHLYRFNGNDPINVGHERHYP
EDFAAWMRTLGYNVGNLVPQLARDLWQPPALWGRPPANPVALNLRRPFDNIPTMAVESGF
LAHLNVRRMSDFEQLSAPPRSALKCDVMDPSPKTIGSDTEPPFGKGIVVSRTADGQAIVS
SVPAANAIYRDVYTSVFNRSKLLPFTFVVHNAQQDSFFFVKEDAWRATEDRQQLKRLQGQ
VNTTFHEITREATVGSGPAGAANGGAGSSSSSSSSSGGGSSSNTGNYLDVKIHGAHAIIN
LRYGTTVAKEQQRLMHHAKLTAVRKAWHREKEALRSGLTTALEWSQQETDEILKQSYANN
YEGEYIHDVNLYPELAEDPYNIKFVKKKGATGGAAGVPNSRRRRRRSTDLIQEEEEELHR
EADC
Download sequence
Identical sequences M9PJK5 Q9VYN8
FBpp0289136 FBpp0289138 FBpp0289440 FBpp0289441 NP_001138190.1.81976 NP_001162731.1.81976 NP_001245640.1.81976 NP_001259483.1.81976 NP_511137.3.81976 FBpp0289136 FBpp0289138 FBpp0289440 FBpp0289441 FBpp0300541 FBpp0301779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]