SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289972 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289972
Domain Number 1 Region: 3-63
Classification Level Classification E-value
Superfamily RING/U-box 5.06e-17
Family ZZ domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289972   Gene: FBgn0037655   Transcript: FBtr0300748
Sequence length 599
Comment pep:known chromosome:BDGP5:3R:4836004:4839754:-1 gene:FBgn0037655 transcript:FBtr0300748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRHEGVSCDSCLKSNFNGRRYKCLICYDYDLCADCYEDGVTSTRHLVEHPMQCILTRSD
IELYFGGEMLASDQPQSFTCPYCKKMGFSDATLLEHVSAEHTETSLEVVCPVCAGLPGGE
PNLVTDDFAGHLTLEHRQGPRELISFLDEPSAIRHGGGVRRIPGRTLGGPRTRRSNMHFS
SSSGLSALSPSGRESVDPIAELLSQLSGVRRGGPPTSQLQQLQMQMQLDRQQVTASRQID
RLPRRAHPIVSTSNSNAAMAEVISGGAGGSGGSGAVGSGSGGGSGATAPPNLRTTEWPVT
ASFSTSASNHSQTQSSLAANSLNAREAIGTSSSAGSNVLGISVGVGGTANGNGGAGSSGV
ATGAGGAGQGGGQGGAAAGESFLLAQFMQPTFTEAEWAVVESMRADRSMFVQSLMLSMLC
TEALDLNASDESLAKSDNVNKGQQQQQEDAEAEAQAETLLNNNADVEQQQQQQQLQPAMV
RQVNQMQQTSPEDFVCDEYRYKNKKANTTQTSGTGGLGGAGATAAPGGGASGAGTKPTAD
RGIERRSGRPPPGEMATGSQQPQQQQQSTANPAASQQKYKQNASAATAAGNTNQIPDTR
Download sequence
Identical sequences Q95RX5
FBpp0289967 FBpp0289967 FBpp0289968 FBpp0289969 FBpp0289970 FBpp0289971 FBpp0289972 FBpp0289967 FBpp0289968 FBpp0289969 FBpp0289970 FBpp0289971 FBpp0289972 NP_001163560.1.81976 NP_001163561.1.81976 NP_001163562.1.81976 NP_649861.3.81976 NP_731305.2.81976 NP_731306.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]