SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290516 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290516
Domain Number 1 Region: 347-687
Classification Level Classification E-value
Superfamily Subtilisin-like 1.01e-87
Family Subtilases 0.00000000103
Further Details:      
 
Domain Number 2 Region: 681-830
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.1e-39
Family Proprotein convertase P-domain 0.00015
Further Details:      
 
Domain Number 3 Region: 986-1147
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.78e-32
Family Growth factor receptor domain 0.00054
Further Details:      
 
Domain Number 4 Region: 1280-1432
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.06e-25
Family Growth factor receptor domain 0.00058
Further Details:      
 
Domain Number 5 Region: 1135-1283
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.41e-24
Family Growth factor receptor domain 0.0013
Further Details:      
 
Domain Number 6 Region: 239-310
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 3.57e-23
Family Prohormone convertase 1 pro-domain 0.0011
Further Details:      
 
Weak hits

Sequence:  FBpp0290516
Domain Number - Region: 1535-1614
Classification Level Classification E-value
Superfamily Flagellar hook protein flgE 0.0288
Family Flagellar hook protein flgE 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290516   Gene: FBgn0004598   Transcript: FBtr0301301
Sequence length 1655
Comment pep:known chromosome:BDGP5:X:16267121:16275578:1 gene:FBgn0004598 transcript:FBtr0301301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNTTRSSRVTIGRIGTTPQITDPWSSGLEKQRPSRCGGPKSLAEPTYRKIGRRKMMLHM
RVHDPGTTVTQRAKETATAKLNRIYLCTFNRMAQSCIYFVLFLVILSPNTSCALRSSAGE
TQNYVGILSNDSATTTYDVSSLHSSRRTNPPSSSSSSSSNVDVDYRNDRELHKVDLVGLG
GERAGQAETISGGKYDYNYENTHTNASAKDEIVERQSNSLDFDGVDMFGAFSIPEEAIYT
NEFAVNIPAGKQMADVIATKHGFINRGQIGSLDNYYLFQHHHVSKRSLRSSRKHQGALKS
ENEVKWMQQQHEKVRRKRDGPYQDLPTYKSISLASHSQRMEYRDVSSHFIFPDPLFKEQW
YLNGGAKDGLDMNVGPAWQKGYTGKGVVVSILDDGIQTNHPDLAQNYDPEASFDINGNDS
DPTPQDNGDNKHGTRCAGEVAAVAFNNFCGVGVAYNASIGGVRMLDGKVNDVVEAQALSL
NPSHIDIYSASWGPEDDGSTVDGPGPLARRAFIYGVTSGRQGKGSIFVWASGNGGRYTDS
CNCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLATTYSSGTPGHDKSVATVDMDGSLR
PDHICTVEHTGTSASAPLAAGICALALEANPELTWRDMQYLVVYTSRPAPLEKENGWTLN
GVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQHICKSRENNEDRKIDGAYGSTLSTHMD
VNGCAGTINEVRYLEHVQCRITLRFFPRGNLRILLTSPMGTTSTLLFERPRDIVKSNFDD
WPFLSVHFWGEKAEGRWTLQVINGGRRRVNQPGILSKWQLIFYGTSTQPMRLKSELLNSS
PQLRSPSSSNPFLFPSASNIGQPANEGGNFNTDSFASYLNYQNIFSSAGSDPEPATATLD
GQNVTAAIAGGSSAESLGFTASAAQLVAAPETRDGDKKILHSCDAECDSSGCYGRGPTQC
VACSHYRLDNTCVSRCPPRSFPNQVGICWPCHDTCETCAGAGPDSCLTCAPAHLHVIDLA
VCLQFCPDGYFENSRNRTCVPCEPNCASCQDHPEYCTSCDHHLVMHEHKCYSACPLDTYE
TEDNKCAFCHSTCATCNGPTDQDCITCRSSRYAWQNKCLISCPDGFYADKKRLECMPCQE
GCKTCTSNGVCSECLQNWTLNKRDKCIVSGSEGCSESEFYSQVEGQCRPCHASCGSCNGP
ADTSCTSCPPNRLLEQSRCVSGCREGFFVEAGSLCSPCLHTCSQCVSRTNCSNCSKGLEL
QNGECRTTCADGYYSDRGICAKCYLSCHTCSGPRRNQCVQCPAGWQLAAGECHPECPEGF
YKSDFGCQKCHHYCKTCNDAGPLACTSCPPHSMLDGGLCMECLSSQYYDTTSATCKTCHD
SCRSCFGPGQFSCKGCVPPLHLDQLNSQCVSCCQNQTLAEKTSSAACCNCDGETGECKAT
STGGKRRTVVGSGSAYKSSESKHGSFENDGNAREFVLRLDSPLTAITAIAVAICLLIITI
FSIIFAVLQRNSNHVSRNSVRYRKIANTSSGRRKNLSAKPTSDARFIFNIGEDDDTDGDN
SDDELDGNVGTDINNRIVYDRKGNDHGHEFYIESTNDIDAIEFHCNGAGAQKAETQLQRC
NANGDDDDILHYDRHTNAERKNHPSSTTSRTNIRS
Download sequence
Identical sequences E1JJL4
NP_001162774.1.81976 FBpp0290516 FBpp0290516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]