SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290562 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290562
Domain Number 1 Region: 2554-2663
Classification Level Classification E-value
Superfamily Bromodomain 1.02e-35
Family Bromodomain 0.0000421
Further Details:      
 
Domain Number 2 Region: 2493-2547
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.87e-16
Family PHD domain 0.00065
Further Details:      
 
Domain Number 3 Region: 2437-2492
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000332
Family PHD domain 0.0016
Further Details:      
 
Domain Number 4 Region: 335-391
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000399
Family PHD domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290562   Gene: FBgn0000541   Transcript: FBtr0301348
Sequence length 2669
Comment pep:known chromosome:BDGP5:3L:233926:246912:-1 gene:FBgn0000541 transcript:FBtr0301348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGSRKRGRPPKTPNERASGRFNYQLLKKPKYLSEGKSQPSTPSASRGISPQSDEGSR
SSHNNHTNRSRGSAAKRGRGRKSAVQPNTSSYSGRKGYESEYHYGSDFGDSEEDKSDNED
DMLLTPSDDESLEVANESESEFSVCSFNQNGVGRPPRPPSPEPVWLQEGRQYAALDLPDS
SEDLFIANTHVLRALSIYEVLRRFRHMVRLSPFRFEDLCAALACEEQSALLTEVHIMLLK
AILREEDAQGTHFGPLDQKDTVNISLYLIDSITWPEVLRSYVESDKTFDRNVFHILSHTE
YPYTGIDNRLEVLQFLSDQFLTSNSIRDVMLQEGPIHYDDHCRVCHRLGDLLCCETCPAV
YHLECVDPPMNDVPTEDWQCGLCRSHKVSGVVDCVLPQEKQGVLIRHDSLGVDRHGRKYW
FIARRIFIEDQENFTCWYYSTTSKLKLLLSRLDAEELETRLHSQITERRDEIERQMKLTE
TLTNEHKHTKRSVIEIEQEAKNELLEKEVLDEDEKDGDAKSESQSIEGTKKQEECKMVTR
QKSNQLTNGTLHFKLGMEQGFKNYVNQYSTNPIALNKPQRNEERDKRRHLSHKFSLTTAS
DFKWIGITMGTTDNMITTLRQTLINFESNIAASFLNINWVVNKKIWNAAVMNARRPSEFA
VVLLLFQASLKSVVFANVWHEQLGHTTLQRITSAEREERKKLEKREKRERDDEEERNRLA
FNYIKYTLGLKHQVWKQKGEEYRVHGQWGWLWLSSSRRCGVRARRAQPLTHNRVYVHYTM
GEENDVNEIILVDPRTQRFMQQCESSNVDGQVCHYLPDQYKNVKVIEDVTEKIKGHIDVS
KALNAPGRTYYSKVARKSRLDDLLDRRLKLAEVEEQMASKIPSDMKPLLVSSQNNTANSK
QTFLEKRLLRLTEVQAKGGPANVNLELVNSLAKQIQTVRLQFSQLNRFAKVFRCYTKECN
TNSNAVSQITQNTCYSPLCLQKARAKKELLLLLRKAHTAGNGSKETVAAILGAVKKPSIL
EQKLTEGKRESTQVAVDDSEEGKPAESEAPLDLLQDWEHARAHAVPFSDSLLTECILVDQ
ECVTNTKIKQEVNASSGCNTTPDSNTQDSDKIDYIESMDVCSNVEIESTEDSIVTGLNSG
NAEDVDMTPGWRRKRNQKSKKSYIGTKDVLDQTLDKDIPLNKQNRRFPITARPVKRECVK
KYERETFENGNERVYSTSSPRGRVYLLNDAAKLYEQAVKTEDKSTITKKPSYSRYPLISN
FLTHKKKRSLLVLPRFELLKLARLGGKSSTNGFHHAAKNNTIWQYQCSRPLFRTCWSYRT
SNATSLSSLALQLRILWSCLRWDDMIAKPPSTDGKHQVTTDTEIVTLELLKLRHSGRYGE
KTSYLRRKVVIPLEMPKTVREVTSIRSGLRKRKRAESPQPTEPQITEEWVDEDKLELWEI
KFMGEKQEKARLSAVTRSVASRQLEASGSNGSNTSTNGALGVAGRVQLAPKLSEDVKEKM
EQQLKLQRAVHQQRKLVATGEITRSVTPVKGQVIGSRRVIVKNPDGTTRIIQQAVTQVSR
TGGANTAAAAASPTVGGSTSTQSNPSTSTPHKVQIIRGPDGKVSVRGLNPGQQLVQMPDG
KLHVLTTTTSSNSAGQGNKMKVPIKPASTSSSPAISSAQTTTNPVTPVIKQIAVKHVTKN
SATQSIASSSRVALPLAQIKNKLLLAQQQQQSTSSSPATSSSPVQKIVSKVVNTSTSGQT
LQQVFVQSGSKLVVGQNAQGQKVIISTSAAQQQGTSPVQQQQLVQSQPIQQSPQQISMTQ
VGNQPTQKVIQQIVNTSNVQQQIVVGGQRIILSPGQTIVTQRNVPQSQALQMVQQQIQTQ
QQQQQHHVVQPQQQFVVQSNQIVQSSPSAQTKLVKQLVVQQQSQQTIEEKTQITTTDSNE
TGTQQVLVPNSTLAQQLAQGKLQVATVNGQQVIVKPLGNNQAQIVAHIKHQGDGNAHIVT
SNSATAVPQANPQTSPVKQQALPPQSPQQVVVQQQQIHQQSPTNFESGVTPITQQPVLTQ
AVQAPAQQQALSVEESLLQNQPPGTVIKCVTAQVLQTEHGPRIVLQGLVGNDFTAQQLQL
VQTQVKQQLMKAQESNGKLGVLGPTKIYLAVQPENAVQSQPPPLTPVHQSAAHQQTNNIE
IDADTLATTYEANSTIKDIAINNGDDQENSKCAETENSNITTNESFAGTSSLLEGSEHDE
PTNLAGLDISETDLENKQNESFVVTRGYIQKSISNALKQGNLSPELEEKLVCMQKQQENA
NSTNEWETCSRGSVNEEALTPSRQTDDTEWKIRTSLRRPNAMTTSSQFNRILKKNRSKND
EVAELGEQKQSQLERHKELLKKNILRKRSLLERNLQSEIHEDVKTKVQRHVRPLSNASPD
EQSENERSGEPNLDFKRTEVQNPRHGAGRPKKLTRKKEKLYCICRTPYDDTKFYVGCDLC
SNWFHGDCVSITEEASKKLSEFICIDCKRARETQQLYCSCRQPYDESQFYICCDKCQDWF
HGRCVGILQSEAEFIDEYVCPECQRKNDANAANMKKLTSNDVEELKNLIKQMQLHKSAWP
FMEPVDPKEAPDYYKVIKEPMDLKRMEIKLESNTYTKLSEFIGDMTKIFDNCRYYNPKES
SFYKCAEALESYFVQKIKNFRENVFDQRT
Download sequence
Identical sequences E1JHV6 Q9W0T1
FBpp0072421 FBpp0290562 FBpp0072421 FBpp0072421 FBpp0290562 FBpp0304414 7227.FBpp0072421 NP_001163304.1.81976 NP_001261190.1.81976 NP_728507.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]