SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290880 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290880
Domain Number 1 Region: 613-867
Classification Level Classification E-value
Superfamily YWTD domain 9.16e-56
Family YWTD domain 0.00000232
Further Details:      
 
Domain Number 2 Region: 939-1177
Classification Level Classification E-value
Superfamily YWTD domain 6.54e-51
Family YWTD domain 0.00000452
Further Details:      
 
Domain Number 3 Region: 1227-1477
Classification Level Classification E-value
Superfamily YWTD domain 6.54e-46
Family YWTD domain 0.00000436
Further Details:      
 
Domain Number 4 Region: 1534-1762
Classification Level Classification E-value
Superfamily YWTD domain 6.28e-42
Family YWTD domain 0.0000131
Further Details:      
 
Domain Number 5 Region: 439-477
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000144
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 265-302
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 7 Region: 305-350
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 394-431
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000772
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 499-604,868-914
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000107
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 10 Region: 1182-1222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000194
Family EGF-type module 0.012
Further Details:      
 
Domain Number 11 Region: 345-391
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000458
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 12 Region: 231-261
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000118
Family LDL receptor-like module 0.001
Further Details:      
 
Weak hits

Sequence:  FBpp0290880
Domain Number - Region: 1797-1834
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000106
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 1488-1531
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000167
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290880   Gene: FBgn0030706   Transcript: FBtr0301666
Sequence length 2008
Comment pep:known chromosome:BDGP5:X:15805013:15814812:1 gene:FBgn0030706 transcript:FBtr0301666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLTAFPFWPLVCFVWLCLGLGDLTKTAVKRNAPHYGIHPTNALGRWDWNKHKQLHSDAR
IGHLEAGNESREDQLSEELSKFGEKLFPVSNYPPYQQNNEDSQEVHHSGEGRLHTMESSV
PSKTRISGGTNSNDTPKFRNIGAQRGRTEIAGIRETDRISSRGRDGFIGGPSNKQKPFRV
NLAVLVQDDPSQPGETYSNCQNSNESDENCNPEEDAVPNLQRDCEKTGIHVMCPRTFRCI
SKYWLCDGDDDCGDYSDETHCGARTNCTDDQFECLNGFCIPRTWVCDGENDCKDFSDETH
CNRTTCTDEHFTCNDGYCISLAFRCDGEHDCNDNSDELKCAAVINSCPEGEFKCRGGLGG
AGGPSGQCILNRFRCDGDNDCGDWSDEENCPQKPSLCTSNEYKCADGTCIPKRWKCDKEQ
DCDGGEDENDCGSLGSEHPLTCGSDEFTCNNGRCILKTWLCDGYPDCAAGEDEVECHLQC
DLGQFLCPTKQNLTNLKICVHQKHICDGHNECPAGEDEADCPKERKCSEPSPCEQLCIET
TAGSNECACRLGYVMDKNKVNCTDIDECQYLTSPVCSQKCHNTMGSFKCSCETGYILRPD
LRSCKALGGAMTLLVANRWDIRRVTLSNNRYSAIVKGLHNAIALDFHHRKGLMFWSDVST
DVIKMVYMNGTRVRDVIKWGLESPGGIAVDWIHDLLFWTDSGTRRVEVSNFQGNLRTVIA
SYDLDKPRAIVVHPGEALAFWSDWGPNPKIERAYMDGTQRKVIISKGVTWPNGLAIDFPN
SKIYWADAKQHAIECSNLDGSDRNKILSTHLPHPFALTLFEDTMYWTDWNTKTVSAADKI
TGKEFRAVHENFHFPMDIHAYHPARQPEYADRCQKDRRGLRGGCSHLCLPNKTSRRCGCP
IGLSLKEDGKTCKSTADKLVLVARRKDIRLRHLRDNQADPNDVDMIVPLDNLKHAVALDW
CSDTDFIYWTDVERSTINKAHLNGSYQQRVVHSNLVSPVGLALDWITDKLYWTDPSTNRI
EVATTNGKMRTLLIWEKLYKPRDIVVNPIEGFMFWSDWGDDPMIERANMDGHERVTITSK
KLIYPNGLAIDYEKSKIYFVDGGTKTLENMNFDGSGRQVILNGLGHPFGLDVNEGRVFWT
DWDTKSVMSANKLTGKDTNVIIANSTDLMDIRVFHRTRRRIFNACDKLNGGCSHLCLLNP
TSYTCACTVGVQLKEDRHTCSEGPTQYILFAHRIDIRQISLDFDHLIDVVLPLPPISNAV
ALDVDRKTGYIYWSDTIENVIMSSSPDGLHVQKIVGDSLENPDGLVVDSIGRTIYWADAG
RHTIEVASLDGSNRHVIAYKDLESPRGLALDYEAGLLFWTDWGHYRKIERSHLDGNERSR
IVTANLGWPNGLSLDLKSKRIYWVDARLKTIDSCDYTGNQRKLIMSSLHHPYALALSDDN
IYWTDWKSKALHMTERRNISAKRDIITNIDGLMDIKIIYQNQNQSTMKNACGNNNGNCSH
LCLRNPSGYSCQCPIGLRLRQNSTTQCQNLPEDYLLIALRSGIGMISLNSGDFMDVVLPI
NGVHGAVVLDYHYRKNLLFFADVNLDVIRRVNLLNLTESKVIVGTDVLTPNGIAVDWIAD
NLYWSDTDRKLIEVSRLDGSCRKRIVEDNLGDPRSLIVHPKKAYLFWSDWSSPAKIERSY
LDGSNRTVIITSGIGFPTGLTIDFTNRRLLWADALEDNIGQVDFNGKRRQTIVPYAPHPF
GLTLFENSIFWTDWYNKSVYRSQKLARSGYGNPFEVRDALSGALDIRAVSLSRQPKSVNH
CAQDNGGCTHLCLNRNVDYVCACPDVMDPKDVACSIKPKVLVHANLENDQLLEYSDESTD
DSTPPELLGESNDHGDDGHTKKSDQEREFFVLVALGVVIVMVVIIILVIFMLAFNTSKKK
NKRNSRGSSRSVLTFSNPNYNVDGTPMEPKTNIWKRFKYDKTHERAGVYEERSLTTETAS
SSLFVPTPSPMASPSTKTIQLTTLSTIT
Download sequence
Identical sequences B5X533
FBpp0290880 NP_001162769.1.81976 NP_001285307.1.81976 FBpp0290880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]