SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291053 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291053
Domain Number 1 Region: 2707-2793
Classification Level Classification E-value
Superfamily Immunoglobulin 1.03e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 2 Region: 1858-1917
Classification Level Classification E-value
Superfamily BPTI-like 3.12e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0039
Further Details:      
 
Domain Number 3 Region: 1788-1843
Classification Level Classification E-value
Superfamily BPTI-like 6.67e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0022
Further Details:      
 
Domain Number 4 Region: 2473-2556
Classification Level Classification E-value
Superfamily Immunoglobulin 4.01e-17
Family I set domains 0.016
Further Details:      
 
Domain Number 5 Region: 1942-1995
Classification Level Classification E-value
Superfamily BPTI-like 4.54e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0019
Further Details:      
 
Domain Number 6 Region: 1608-1664
Classification Level Classification E-value
Superfamily BPTI-like 7.8e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0015
Further Details:      
 
Domain Number 7 Region: 1668-1722
Classification Level Classification E-value
Superfamily BPTI-like 1.28e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0032
Further Details:      
 
Domain Number 8 Region: 2068-2123
Classification Level Classification E-value
Superfamily BPTI-like 1.7e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0046
Further Details:      
 
Domain Number 9 Region: 1729-1782
Classification Level Classification E-value
Superfamily BPTI-like 1.84e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0026
Further Details:      
 
Domain Number 10 Region: 2257-2316
Classification Level Classification E-value
Superfamily BPTI-like 3.12e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0037
Further Details:      
 
Domain Number 11 Region: 2133-2188
Classification Level Classification E-value
Superfamily BPTI-like 6.24e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.005
Further Details:      
 
Domain Number 12 Region: 2194-2247
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000129
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0035
Further Details:      
 
Domain Number 13 Region: 2011-2066
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000213
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0026
Further Details:      
 
Domain Number 14 Region: 2569-2648
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000464
Family I set domains 0.012
Further Details:      
 
Domain Number 15 Region: 460-520
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000017
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 16 Region: 338-396
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000235
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 17 Region: 2394-2440
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000732
Family Elafin-like 0.0018
Further Details:      
 
Domain Number 18 Region: 58-110
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000994
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 19 Region: 638-680
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000222
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 20 Region: 579-633
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000444
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 21 Region: 399-457
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000017
Family TSP-1 type 1 repeat 0.0068
Further Details:      
 
Domain Number 22 Region: 524-576
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000379
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291053   Gene: FBgn0003137   Transcript: FBtr0301839
Sequence length 2841
Comment pep:known chromosome:BDGP5:3R:24346387:24366053:-1 gene:FBgn0003137 transcript:FBtr0301839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLSRRLCSTALVAFIVLASIHDSQSRFPGLRQKRQYGANMYLPESSVTPGGEGNDPDEW
TPWSSPSDCSRTCGGGVSYQTRECLRRDDRGEAVCSGGSRRYFSCNTQDCPEEESDFRAQ
QCSRFDRQQFDGVFYEWVPYTNAPNPCELNCMPKGERFYYRQREKVVDGTRCNDKDLDVC
VNGECMPVGCDMMLGSDAKEDKCRKCGGDGSTCKTIRNTITTKDLAPGYNDLLLLPEGAT
NIRIEETVPSSNYLACRNHSGHYYLNGDWRIDFPRPMFFANSWWNYQRKPMGFAAPDQLT
CSGPISESLFIVMLVQEKNISLDYEYSIPESLSHSQQDTHTWTHHQFNACSASCGGGSQS
RKVTCNNRITLAEVNPSLCDQKSKPVEEQACGTEPCAPHWVEGEWSKCSKGCGSDGFQNR
SITCERISSSGEHTVEEDAVCLKEVGNKPATKQECNRDVKNCPKYHLGPWTPCDKLCGDG
KQTRKVTCFIEENGHKRVLPEEDCVEEKPETEKSCLLTPCEGVDWIISQWSGCNACGQNT
ETRTAICGNKEGKVYPEEFCEPEVPTLSRPCKSPKCEAQWFSSEWSKCSAPCGKGVKSRI
VICGEFDGKTVTPADDDSKCNKETKPESEQDCEGEEKVCPGEWFTGPWGKCSKPCGGGER
VREVLCLSNGTKSVNCDEEKVEPLSEKCNSEACTEDEILPLTSTDKPIEDDEEDCDEDGI
ELISDGLSDDEKSEDVIDLEGTAKTETTPEAEDLMQSDSPTPYDEFESTGTTFEGSGYDS
ESTTDSGISTEGSGDDEETSEASTDLSSSTDSGSTSSDSTSSDSSSSISSDATSEAPASS
VSDSSDSTDASTETTGVSDDSTDVSSSTEASASESTDVSGASDSTGSTNASDSTPESSTE
ASSSTDDSTDSSDNSSNVSESSTEASSSSVSDSNDSSDGSTDGVSSTTENSSDSTSDATS
DSTASSDSTDSTSDQTTETTPESSTDSTESSTLDASSTTDASSTSESSSESSTDGSSTTS
NSASSETTGLSSDGSTTDATTAASDNTDITTDGSTDESTDGSSNASTEGSTEGASEDTTI
STESSGSTESTDAIASDGSTTEGSTVEDLSSSTSSDVTSDSTITDSSPSTEVSGSTDSSS
STDGSSTDASSTEASSTDVTESTDSTVSGGTSDTTESGPTEESTTEGSTESTTEGSTDST
QSTDLDSTTSDIWSTSDKDDESESSTPYSFDSEVTKSKPRKCKPKKSTCAKSEYGCCPDG
KSTPKGPFDEGCPIAKTCADTKYGCCLDGVSPAKGKNNKGCPKSQCAETLFGCCPDKFTA
ADGENDEGCPETTTVPPTTTTEETQPETTTEIEGSGQDSTTSEPDTKKSCSFSEFGCCPD
AETSAKGPDFEGCGLASPVAKGCAESENGCCPDGQTPASGPNGEGCSGCTRERFGCCPDS
QTPAHGPNKEGCCLDTQFGCCPDNILAARGPNNEGCECHYTPYGCCPDNKSAATGYNQEG
CACETTQYGCCPDKITAAKGPKHEGCPCETTQFGCCPDGLTFAKGPHHHGCHCTQTEFKC
CDDEKTPAKGPNGDGCTCVESKFGCCPDGVTKATDEKFGGCENVQEPPQKACGLPKETGT
CNNYSVKYYFDTSYGGCARFWYGGCDGNDNRFESEAECKDTCQDYTGKHVCLLPKSAGPC
TGFTKKWYFDVDRNRCEEFQYGGCYGTNNRFDSLEQCQGTCAASENLPTCEQPVESGPCA
GNFERWYYDNETDICRPFTYGGCKGNKNNYPTEHACNYNCRQPGVLKAKDICEIPAEVGE
CANYVTSWYYDTQDQACRQFYYGGCGGNENRFPTEESCLARCDRKPEPTTTTPATRPQPS
RQDVCDEEPAPGECSTWVLKWHFDRKIGACRQFYYGNCGGNGNRFETENDCQQRCLSQEP
PAPTPPRAPAPTRQPDPAPTVAQCSQPADPGQCDKWALHWNYNETEGRCQSFYYGGCGGN
DNRFATEEECSARCSVNIDIRIGADPVEHDTSKCFLAFEPGNCYNNVTRWFYNSAEGLCD
EFVYTGCGGNANNYATEEECQNECNDAQTTCALPPVRGRCSDLSRRWYFDERSGECHEFE
FTGCRGNRNNFVSQSDCLNFCIGEPVVEPSAPTYSVCAEPPEAGECDNRTTAWFYDSENM
ACTAFTYTGCGGNGNRFETRDQCERQCGEFKGVDVCNEPVTTGPCTDWQTKYYFNTASQA
CEPFTYGGCDGTGNRFSDLFECQTVCLAGREPRVGSAKEICLLPVATGRCNGPSVHERRW
YYDDEAGNCVSFIYAGCSGNQNNFRSFEACTNQCRPEPNKQDNEIGQNPCDTFDAECQEL
RCPYGVRRVAARSQPECTQCICENPCEGYSCPEGQQCAIDVASSDDRQFAPVCRDIYKPG
ECPALSANASGCARECYTDADCRGDNKCCSDGCGQLCVHPARPTQPPRTQAPVVSYPGDA
RAALEPKEAHELDVQTAIGGIAVLRCFATGNPAPNITWSLKNLVINTNKGRYVLTANGDL
TIVQVRQTDDGTYVCVASNGLGEPVRREVALQVTEPVSQPAYIYGDKNVTQIVELNRPAV
IRCPAGGFPEPHVSWWRNGQMFGLKNNLMARDYSLVFNSIQLSDLGLYTCEVYNQRRPVS
LRVTLKAVGPVRPLSPEEEQYMQYVLNPATRPVTQRPSYPYRPTRPAYVPEPTVNVHAVL
ALEPKNSYTPGSTIVMSCSVQGYPEPNVTWIKDDVPLYNNERVQITYQPHRLVLSDVTSA
DSGKYTCRASNAYTYANGEANVSIQSVVPVSPECVDNPYFANCKLIVKGRYCSNPYYTQF
CCRSCTLAGQVASPPLHPNAV
Download sequence
Identical sequences FBpp0291053 NP_001163761.1.81976 FBpp0291053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]