SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291843 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291843
Domain Number 1 Region: 101-483
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.38e-92
Family Ankyrin repeat 0.000011
Further Details:      
 
Domain Number 2 Region: 1242-1316
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000237
Family SAM (sterile alpha motif) domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291843   Gene: FBgn0261554   Transcript: FBtr0302703
Sequence length 1550
Comment pep:known chromosome:BDGP5:2R:17185529:17196939:1 gene:FBgn0261554 transcript:FBtr0302703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRTPKLQLVGRAYSEMSPLNPDSLTDSPTTSSAGQDRRADQSGYGSIFPFGLLRGSFGR
GGNASQNINRFGDSMGSLGHRALLQYIDNNDISGLRAILDSRHLTIDDRDENATTVLMVV
AGRGLTAFVREFLARGADVQAEDLDNWTALLCASRNGHLDVVQLLLDHGAEVEHRDMGGW
TSLMWAAYRGHTELVRLLLDKGADGNAHGNYHLGALLWAAGRGYKDIVELLVQRGAKVNV
GDKYGTTALVWACRRGNVEIVDTLLKAGANVDTAGMYSWTPLLVAAAGGHTDCVSSILEK
KPNVNALDKDGMTALCIASREGFQDIAASLIAAGAYINIQDRGADTPLIHAVKAGHRTVV
EALLKKHADVDIQGKDRKTAIYTAVEKGHTPIVKLLLATNPDLESATKDGDTPLLRAVRN
RNLEIVHLLLDRKAKVTASDKRGDTCLHIAMRARSKTIVEALLRNPKHSQLLYRANKAGE
TPYNIDSLHQKTILGQVFGARRLNTNEDSEGMLGYELYSSALADVLSEPTLTTPITVGLY
AKWGSGKSFLLNKLRDEMNNFARQWAEPPIRTSGLLFIVCLHVALLIGTIVGLSTWSAVV
GVSAAVGFLLLAYLLLAAVRYCNYQMDMQWAYSVQHGLEKRMTRLRLILQVAFCHPPGPQ
SDSQAKPVRFHFAEANSASPTGDGAVAHMLAALLDAIESHYGWLATRLYRAFRPKCLKVD
VGWRWRRMCCIPIVLIFELALVTVVTGISLTVAYFTFADEKEKEHILVALYVIAAVMGTL
ICTHLHVLAKVFVSLFTSHIRVLKRAVRSSESAPLTMLGAEVAVMTDMVKCLDAFTNQQS
RLVGVIDALDSCDTERILTLLNAVQTLLSSPNRPFVLLISVDPHVIAKAAEANSRRLFTE
GGIGGHDFLRNLVHLPVYLQNSGLRKVQRAQMTALLFKRSGGGDYQTDDGPTLGHSVSAR
RLSNASEIISSQEKLRGPARGGGGKKLRLSESVASSTGSNLHRLGQNPQTVLDLSRIVLT
DDYFSDVNPRSMRRLMNVIYITVRLLKAFQIEFSWYRLSSWINLTEQWPLRASMIVLHHD
QFMDSNADESVSLQSVYEKLRPKLAYLREAAPLLELDRDERKLDAFLQLHKSDLLVADLR
IFLPFTINLDPYLRKVLKEDQQTIEDEGSLVIQARPSVSNTMRQFPAPTTYVPSPQAYPP
YQMFQNEYPANELRSRNLSTSTEPVTPLINSPSDSFGDDILQTKLTDLTVEGVISLLDRI
EDMKPALPKLAPVLRENAINGRVLKHCDMPDLKSVLGLSFGHWELFRLLITTLRECERLP
RKQQRQQQQPGALEAPSNVPMIKDVTDALMQPPRESLSRKNSVSHMEKQVTLEEQMICGT
LQTLNEEAYEDVASSERPSPTGEMLAAVAQLQLAPIRESSEFGSPSDDQKQYGVKISNNN
NNNQYLHAEYNRSVSSHSLQSLSTLVGAPVGHGGSGGSHLHLGNGNDLSDSTLDLMHVDS
VFGGGGGGGYHRASRQISISSELLHESSSLPMVVVIPNASGEQAYDDTKL
Download sequence
Identical sequences B7YZM5
NP_001137725.1.81976 FBpp0291843 FBpp0291843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]