SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0292762 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0292762
Domain Number 1 Region: 740-856
Classification Level Classification E-value
Superfamily Bromodomain 2.09e-33
Family Bromodomain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0292762   Gene: FBgn0261934   Transcript: FBtr0303749
Sequence length 3080
Comment pep:known chromosome:BDGP5:3L:6723262:6736264:-1 gene:FBgn0261934 transcript:FBtr0303749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSTFIGLLDIQSWWEIPCISHFCSLFSSAFDLPDIDIEDLESALLSDGTSDEDQVALVP
ELIVRLLKGCDALQTVAKEITHSNYQMFLRRFLRQQCRLHQTENHFDTDIDFQSLPVRKR
LHILHDLCHFRLDSVDVQVILSNLEADSLRVEPLGYDAKNSGYWYFYGTRLYREDKATGG
SASSSSGSGSGGAGASTGGASNSKGIGSNGTVWQVICFTEEDWQNLAAKFKTSTNAKERE
LFNILDDNFLPKLPQLFRERERLRRRKLLQVRNSSRIRNIAELKARQEEERQRRERENLY
QDRQNAHWLAPPQQQQQQQQQQQQQQQQSQQRTRRRSQSTSTASGISTYASSLRRTTTTN
SSEFLCHRETFCLSPENDEDDDDDDEALDAEQQSDQPEQQRQQEEQPPEEEQRQEPEELL
AVSATDDDFRSPEAPKSQTPAELKSKSSHHHHHHHHKKKKSSKKQKKRHHRDKGRERDRE
HHHHHRRRHKHASEADEGEDDNNNHNSNSNSNSNTNSISSNNSVQPKRRRSGQQQQHHQQ
AETTEPSTSLSPEDKENFCRQLQLLDTNSAAIAVATSIADLSLPSPVAHESETEQDEQVD
QPAVVEAQPPALTSAMAPAANVKLPGRQTNNSLSSLTGNIFIPSGSAQQQQQQSQEPPSS
SSSSQSGTTTTASTVRSKKQKAVLNSSGSSSTSKMADKADRNLSKTETTGKSKKSAAGSS
ASSSSSKAERISGAYSDKSGDDFTETEEVLQIGMHKVLVYVKNHRDAWPFVDPVEEDIAP
RYYSIIRRPMDLLKMEDKLDSGEYHKFSEFRNDFRLIVNNCRLYNGHNNEYTEMVNNLQD
AFEKATKKYFDNLSDDEDDDPNLSYPAADSKMNVFREKYFSKKAKEETEKDAPGRPAVSS
AEEDLSEIEAEAPQKAQKRKRKEKDKRRKKKTKSKADVETDDEDMEAEREPTPPPPPPTS
KKSKTSKTGKEKEKDKEKEKDKDKEKDKETSSFKRGRKTKSDKSASKSSKKTKKGAKKSS
ADSDPESDPSDSRESEDYSDDDHISLAKTKSLVKPTARTIAAQKKKSVPAESKVKMPTPV
KRQVKGKGKGGRKAKDDSLDSDQSDVNVKKQLPPTAAAALAESAAELEEDPDDPPPDEDE
DEDSSRSRSMSPFKVDLHKKYSKSALNDDLSELLTTVKKVPTAETTKLSARHQDEADEER
SSRESDGDFKSLSNSRGSSEERPPVAKKGKKAESSKKEKEKKGRDKDRDRDKEKDKDKSR
SAKDKKSKDESPVLVAAAEAAAVVQAELDMLLPFMDKYDVIKYRRSRAAFSGSSASNSLA
PSEDSKSAITKSNRENRKASAKREKSPDAVENKRGRKSKDQKRSKESDKAEKSDKASKAD
TEKHSEKSKKKEEPPKVVEKAQREKSPAPVSALETIKEPPAPTPIATSASGKVKEGPAKK
EPKKRPDKQMPPPPKPADKSSEKGSGKKSSSKKAAQKAGQPQTNNNTNLEALDVETEQTL
KDINRWLEHTPRFTEFSSASNSPSRYNLLDDFDSGIGSKLDAADFRRPVALAAPKAELVP
TKLAEALNELVSEPKEAVSKSESESVAPTPSSVSSSCGTPPHSMHSGNSIGSTSATAASS
SNCSNNSMPTPLPVAVTPTPTPAPPPLLPIPKPKEPSTTQLILNPPPPPHIKQQLAKEAK
RKSLKEKQAAQAAQAQQVKAKANVMRTIDRLQPGKAKGNLLQNVVAVKSTEEGGDSHAGV
NPVTTKVKELKNALITETCEGAPKLSLGTVLKTQDFSLGKSLEEMSGKKDANEDDRPNEE
ASPKNSSPPTTPNTEAPKPFEALHELSKRGKSSEPSKSEASQKEKPNLSAWLKAFGGPKV
SKKSEDEEKQQTPVQDLQGDSKVAPPAHSPAGDNFSLPTVMRQRKPSTGSTNSERSSFSQ
DPDSPRIAIDERYGSYAAGSYTSPIGASPIGASPIMVSPKPNDDMGKPASPYPLNGAIKV
GFYQDTTTKSSPDKSCSPREMNSPYPQYSQHIYSSASSPNVSTPDMSGTSPYGGGNSYNP
SGSEASKTPAYSSTSPLPIYDQYKQPRSQESDYNSSMSPSTPNPHSPYQQPQSSPYTTPQ
QSQSTHPSPYHNQSPYHQQQHSPYHPPAAQQQQQSSQPSHSPAAHQQALSPMHSVESPAS
SAATQPPTPLAQSPAEQQHSPYQQPVLSPYQQPQQQVQPPVVPPVQPSAGAQASTALGNN
GYAPTHDSYQQLQQQQRSLYNPATLINPLSTAASSTASITKPNNDWSLNRSLLPPSITNT
VNQAAQQQQQQQQQQAGQLQQQPQMQAAQQQLQSTPQQQQQQLQGTPQQQQLQGSQQQQQ
QQQQQQQLQTSQQQQQQVLGHQQQHKPKYPTYAQYQSTNAAANAAAAADAVDNLQQQQQK
IAPPTYGSDMATFMQHQMQQPPKTDTLINPLKRPGEEIGMDYSGNAANKMQKREETPAQQ
QQQQQQQQPTQNQTQSLLNKQQQMFNSFLGTMAFGKPIGNIAPDKAFEMYNRAAAMGFPK
DFAKDNSCQLQQQQQQQQSPQVTTNKQQANQQTQQQPQQQSQQSQPHLTQLQTALSQNYQ
QQQQQTQAQKLPQQQQQQPPQQLNYQQQQAQLNHNYTAQQQATAVPDKPPAAQSTVAAAV
SESSSNMMNLPSTAHQHHLSQTHHLAAYNKPTPPPPQTYSNPLMQSMLGYAGNYFDKTMP
PAAHMYSASSSAASAYGNPAQQLPGNYVPGNNNPAHQQQQQPQQQQQQQQQAPAVPPAEV
KAPAKRGRKKKAATIAAEAAAAAAKQQQQQQQQQQQQAQQQQQVAAQQQHQQQQVSAQQQ
QQQHQQVAAQQQQHQAMPQYNMPQSMASAAAATNNQLQAHAQALQQGFQLYAGLKSGGVS
SPVGSSAATPVNSGGSTTNQTAADAAAISLKTSTGGMVPGSAFNFAPTPGTLGLYGDQAA
AASSYLDQFRDAPNPYYMPPAPAHSGTAANPSGNAADKGQNPLNTAAGSYPFLAAAHPSS
RAAAAAAAYPFADPNSQLYQQYLRRDDFHTRMIFNQSLLGGPAAAAAAAGYGQPPPPPSA
YQRAALGMPKPYDINRQSWF
Download sequence
Identical sequences Q8IQ71
FBpp0292762 NP_001261481.1.81976 NP_729188.2.81976 FBpp0292762 FBpp0305261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]