SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293113 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293113
Domain Number 1 Region: 219-396
Classification Level Classification E-value
Superfamily MIR domain 5.49e-39
Family MIR domain 0.0031
Further Details:      
 
Domain Number 2 Region: 1090-1216
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.84e-21
Family SPRY domain 0.023
Further Details:      
 
Domain Number 3 Region: 669-805
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000459
Family SPRY domain 0.057
Further Details:      
 
Domain Number 4 Region: 102-186
Classification Level Classification E-value
Superfamily MIR domain 0.000000209
Family MIR domain 0.025
Further Details:      
 
Domain Number 5 Region: 4210-4272
Classification Level Classification E-value
Superfamily EF-hand 0.000000471
Family Calmodulin-like 0.032
Further Details:      
 
Domain Number 6 Region: 2255-2353
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000392
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 
Weak hits

Sequence:  FBpp0293113
Domain Number - Region: 456-634
Classification Level Classification E-value
Superfamily ARM repeat 0.00719
Family GUN4-associated domain 0.072
Further Details:      
 
Domain Number - Region: 1536-1661
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0261
Family SPRY domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293113   Gene: FBgn0011286   Transcript: FBtr0304571
Sequence length 5130
Comment pep:known chromosome:BDGP5:2R:4747869:4775602:1 gene:FBgn0011286 transcript:FBtr0304571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAEGGSEQDDVSFLRTEDMVTLSCTATGERVCLAAEGFGNRHCFLENIADKNVPPDLS
QCVFVIEQALSVRALQELVTAAGSETDSRLGKGTGSGHRTLLYGNAILLRHHNSDMYLAC
LSTSSSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLH
TTKENEQSIVNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSTWG
REAGQNIVIYEGGVVMAQARSLWRLELARTKWTGGFINWYHPMRIRHITTGRYLGVNDSN
ELILVKKEEASIATTTFCLRQEKDDEKKVLEDKDLEVIGSPIIKYGDTTVIVQHCETSLW
LSYKSYETKKKGVGKVEEKQAILHEEGKMDDCLDFSRSQEEESKTARVIRKCSSLFTQFI
TALETLQSNRRHSIFFQKVNLNEMVMCLEDLINYFSQPEDDMEHEEKQNRFRALRNRQDL
FQEEGVLNLILEAIDKINIITSQGFLASFLAGDETGQSWDLISTYLYQLLAAIIKGNHTN
CAQFANSNRLNWLFSRLGSQASSEGSGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEK
HGRDPKVLDVLCSLCVGNGVAVRSSQNNICDFLLPGKNLLLQTLLVDHVASIRPNIFVGR
VDGSSMYQKWYFEVTMDHIEQTTHMMPHLRIGWANTSGYVPYPGGGKKWGGNGVGDDLYS
FGFDGAFLWTGGRKTLVVDALPEEPFIRKGDVIGVAIDLSVPIITFTFNGVKVRGSFRDF
NLDGMFFPVMSCSSKLSCRFLFGGDHGRLKFAPPMGFSALVQCLMPQQILSLDPCFYFGN
LAKNVLAGPWLIEDDTAFVPKPVDTTGVTLPSSVDQIKEKLAENIHEMWALNKIEAGWSW
GEHRDDYHRIHPCLTHFEKLPAAEKRYDNQLAVQTLKTIISLGYYITMDKPPARIRPVRL
PNEIFMQGNGYKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSE
NHRSPHLVPYAKVDEAIKKANRDTASETVRTLLVYGYVLDPPTGEGTEALLAEAQRLKFA
GFRTYRVERNYAVTSGKWYFEFEVLTSGPMRVGWARADCYPGAMLGSEDTSWAFDGHNVT
KMHAGSIEHFGVRYEAGDVIGCFIDVKEQTISFSLNGELLMDALGGETTFADVTAEGVGF
VPACTLGVGQKARLIYGQDVDSLKFFTTCGLQEGYEPFCVNMRRPVTHWYTKDQPIFENT
EEMPDCRIDVTRIPGGADTPPHLKISHNTFETMEKANWEFLRLSLPVTCMGEFISEQEKA
RRWDEIKNRQYRLMREAEIAAQMQVQTQAAHMDHMLKGGFNMNDIKGLTRNFDEHADAEA
DHMMRGPNRPPRKGSLTRNITFETDMSAALDEMQRSTSVLDMNGLGEEMDDKKKRGRSPF
KFFSKKSRDQSREKMGARTLDTSLERRNTVAHGRNVVNQQMTTRAPTLRLNNAEIPPSPV
PQGPKQLSGSNLGQQPVETSGDEMFDAECLKLINEYFYGVRIFPGQDPTHVYVGWVTTQY
HLHSREFNKNKVRRGSVYIEDDYEMAIERIDRQSCYVVRADELFNEVTQDASGKGASQGM
FVGCFVDTATGIIRFTCEGKDTSHRWMMEPDTKLFPAIFVEATSKEILQIELGRTPTTLP
LSAAVLPTSDKHINPQSPPRLKVQCLRPHQWARVPNTALQVHALKLSDVRGWSMLCEDPV
SMLALHIPEEDRCIDILELIEMDKLLSFHAHSLTLYAALCYQSNYRAAHALCQHVDQKQL
LYAIRSEYMSGPLRQGFYDLLIALHLESHATTMEVCKNEYITPLGAELKELYSDEEMQHS
LRSLVTESVRPQLRMTEITPPVIATSSMPSVSSEPIPDIDQLYSPKFPLEVVRQFVMEAL
KDAVEINQVHNRDPIGWTNENLFLPLIKLTDRLLLVGVLTDEDVQRLLVMIDPETWDQAF
EREGKDEHRKGLLTMKMAEGAKLQMCYLLHHLYDTQLRHRVESIIAFSHDFVGDLQTDQL
RRYIEIKQSDLPSAVAAKKTKEFRCPPREQMNQILCFKNLEPDDQDNCTCGLELRGRLGD
FHDSLMQKVSLNALQEPDGVEGTAIEEVKTGPITKIYNFINTVKELEEGPKEVEEPEKKT
PEEVFRKVLIKTIVSWAEESQIENPKLVREMFSLLLRQYDTVGELVRALEKTYVINTRAR
DDVAEMWVGLSQIRALLPVQMSQEEEELMRKRLWKLVNNATFFQHPDLIRILRVHENVMA
VMMNTLGRRAQAQSDAPTQSEVAEGAPSKEKDTSHEMVVACCRFLCYFCRTGRQNQKAMF
DHFDFLLDNANILLARPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAVYLSRCGLQ
SNSELVEKGYPDLGWDPVEGERYLDFLRYCVWVNGESVEENANLVIRLLIRRPECLGPAL
RGEGEGLFRAIVEANRMSERISDRCKMQDEAEGTIAGLNFTHPLPEGEEDEDYIDTGAAI
LNFYCTLVDLLGRCAPDASVIEQGKNESLRARAILRSLVPLEDLQGVLSLKFTLSQTAPG
EEKPKSDMPSGLLPNNKQSIVLFLERVYGIEAQDLFYRLLEDAFLPDLRTATILDKSDGS
ESDMALAMNRYIGNSILPLLIKHSKFYNEAENYASLLDATLHTVYRLSKNRMLTKGQREA
VSDFLVALTSQMQPAMLLKLLRKLTVDVSKLSEYTTVALRLLTLHFDRCAKYYGSTQGQG
SYGASSDEEKRLTMLLFSNIFDSLSNMDYDPELFGKALPCLIAIGCALPPDYSLSKNTDE
DYYGRQMGAPDQPQYMPNPIDTNNVHLDNDLNSLVQKFSEHYHDAWASRRLEGGWTYGDI
RSDNDRKHPRLKPYNMLSEYERERYRDPVRECLKGLLAIGWTVEHSEVEVALNHRGSTRR
QSKPQINEFQNEGSPFNYNPHPVDMSNLTLSREMQNMAERLAENSHDIWAKKKNEELNGC
GGVIHPQLVPYDLLTDKEKKKDRERSQEFLKYMQYQGYKLHKPSKGGAVEEGGATQAAVE
LRFSYSLLEKLIQYLDRATINMKLLKPSTTFSRRSSFKTATRDIKFFSKVVLPLMEKYFS
THRNYFIAIATATNNIGAASLKEKEMVASIFCKLAALLRNRLSAFGPDVRITVRCLQVLV
KGIDARTLTKNCPEFIRTSMLTFFNQTSDDLGNTILNLQDGKYSHLRGTHLKTSTSLGYV
NQVVLPVLTAMFDHLAACDYGSDLLLDEIQVASYKILAALYHLGTDGTLTHDRKYLKTEI
ERHRPALGSCLGAYSSCFPVAFLEPHLNKHNQYSLLNRIADHSLEAQDIMVKMESCMPNL
ETILAEVDQFVESDKTYNDAPHIIDVILPLLCAYLPFWWSQGPDNVSPTSGNHVTMVTAD
HMNPLLRNVLKMIKKNIGNDNAPWMTRIAAYTQQIIINTSEELLKDPFLPLAERVKKRTE
NMLHKEDSMRGFIKSATDDTSQVETQLQEDWNLLVRDIYSFYPLLIKYVDLQRNHWLKDN
IPEAEELYNHVAEIFNIWSKSQYFLKEEQNFISANEIDNMALIMPTATRRSAISEGAPAV
GGKVKKKKKNRDKKRDKDKEVQASLMVACLKRLLPVGLNLFAGREQELVQHCKDRYLKKM
PEYDVIEFARNQLTLPDKLDPSDEMSWQHYLYSKLGKTEEPVDEQALEKANVNSNEKGKD
KTQETVDRIVAMAKVLFGLHMAASSKNRSKRWGSKISVARRQAVISSLRAKHLYRMSRHR
ACNIFARSYYEQWLQEENVGQEVMVEDLTQTFEDSEKSKKEGEETDSKPDPLTQLVTTFC
RGAMTERSGALQEDLLYMSYAQIAAKSTGKEEEEGGDEEGGEGGEEGEGTSIHEQEMEKQ
KLLFHQARLSNRGVAEMVLLHISASKGIPSEMVMTTLNLGIAILRGGNIDIQMGMLNHLK
EKKDVGFFTSIAGLMNSCSVLDLDAFERNTKAEGLGVGSEGAAGEKNMHDAEFTCALFRF
IQLTCEGHNLEWQNYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKEIIDPAG
KANFFKAIEVASQVFNTLTEVIQGPCTLNQQALAHSRLWDAVGGFLFLFSHMQDKLSKHS
SQVDLLKELLNLQKDMITMMLSMLEGNVVNGTIGKQMVDTLVESASNVELILKYFDMFLK
LADLIESPSFHEVDMKNEGWVTPKDFREKMEQSKNYTPEEMDFLLACCERNHEGKIDYRA
FVEHFHEPSKEIGFNLAVLLTNLSEHMPNEPRLARFLETAGSVLNYFEPFLGRIEILGSS
KRIERVYFEIKDSNIEQWEKPQIRESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMTH
ASGLMATDDGGGNVKRDTAYSSYMSEEEEERAARDPIRRTITAVKEGLKFGVHMLSPANI
KHQIGVMQTKSIPELIVGFFKIIFYIFYYTGYAHFCVVRYIFGILLNLMRGPAPEQEEEP
VVEEETFGRALPPLPLEEPPGTVQAFGLDINKEENGMYKVVVHESPANSSMEEGGESSPE
DGAAASGELVEGEPHQEPISIVDLLGGEAAKKAAQERQEAQKAQEAAMASIEAEAKKSSS
APQETPAVHQIDFSQYTHRAVSFLARNFYNLKYVALVLAFSINFMLLFYKVTSFTEEADS
SAEEELILGSGSGGGADITGSGFGGSGDGGSGDGEMEDEIPELVHVDEDFFYMEHVLRIA
ACLHSLVSLAMLIAYYHLKVPLAIFKREKEIARRLEFEGLFIAEQPEDDDFKSHWDKLVI
SAKSFPVNYWDKFVKKKVRQKYSETYDFDSISNLLGMEKSTFAAQESEETGIFKYIMNID
WRYQVWKAGVTFTDNAFLYSLWYFSFSVMGNFNNFFFAAHLLDVAVGFKTLRTILQSVTH
NGKQLVLTVMLLTIIVYIYTVIAFNFFRKFYIQEEDEEVDKKCHDMLTCFVFHLYKGVRA
GGGIGDEIGDPDGDDYEVYRIIFDITFFFFVIIILLAIIQGLIIDAFGELRDQLESVKDN
MESNCFICGMGKDFFDIVPHGFDTHVQKEHNLANYMFFLMHLINKPDTEYTGQETYVWNM
YQQRSWDFFPVGDCFRKQYEDELSGGGGGG
Download sequence
Identical sequences A0A0B4K6T5
NP_001246210.1.81976 FBpp0293113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]