SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293205 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293205
Domain Number 1 Region: 588-715
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-26
Family Cadherin 0.00056
Further Details:      
 
Domain Number 2 Region: 701-821
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000123
Family Cadherin 0.0044
Further Details:      
 
Domain Number 3 Region: 354-432
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000214
Family Cadherin 0.0045
Further Details:      
 
Domain Number 4 Region: 480-593
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000087
Family Cadherin 0.0047
Further Details:      
 
Domain Number 5 Region: 253-355
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000899
Family Cadherin 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293205   Gene: FBgn0261053   Transcript: FBtr0304663
Sequence length 1943
Comment pep:known chromosome:BDGP5:3R:6652801:6674752:1 gene:FBgn0261053 transcript:FBtr0304663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTSSSQPEKNRSHVPLCRLGTEPVSRTGAAEEPSGQRECYYYAPATSPHQHHHHHHQH
HHHHRLKQHHRHHHHHHRLQHHHHHHQQQHNHQNQQMQHHWPSRLGPIGPWLGAMTAYRL
LTISLLIGILCPHHVQGADPKFDPTTRMRLVLVPADAQVNSVIYRLRATDEEFDYPLTFE
FVGDASASTVKVESLPCTKYNSVCQANIVLQRRLEPGRYYDFQVSVKDTKGGMTTQLCSI
TATNFTTPHDLIFPHKPGIIMIPEDAKRGTELDYVIARKNPLFQKPVYLELWGSPLFAIR
QKIVSSETTEGTVFLLGPLDFEKQAMYHLTILANDAYAEPGQDSRNIAGMEIVVIVQDVQ
DQPPVFTSAPPVTKLPPGILPGDKILQVHAEDGDKGNPREVRYGLVSENNPFTSFFDINE
TSGEIFLMRPLEDIAFITHVGDPVLLTVIAEEVKVGRDEPPALASTVQLAFFLPDRTNSP
PYFENDHYVSRVDENAPHGTALTFVDPYVPRVYDDDTGKNGVFSLTLLNNNGTFEISPNV
AERSAGFLIRVRDNSMLDYEQQQSVQFQILAQELGPATNLSALVNVTVYINDVNDNAPVF
EQPAYSVELPENMTAGTKVVQVLATDPDSGLGGKVRYTAILGYLNTSLNLDAETGLITVS
TNKHGFDREVMPEYHLYVEARDMDGEGNRAQVPLIIKLIDVNDETPIFDKDLYEFILTHD
LMGFTTTAVIHAEDKDATAPNNEVRYEIINGNYDNQFVLDKVTGELTVREKIHLRSKKNA
KTRRRRQAGSDDEDTDIFILTARAYDLGVPVRFSTTTIRVYPPESRKRSVKFVVPGHNPD
KAKTEETLSALSGGKVYIHNIRPLSPDEPGAKDIPAGNPGIKERSVVTATVIYDSSSVVD
ISEIQQRLSHHNNSYAIMPQDTSSTDTQYKAENKVLFWLLILLATLVALTILILLLCCIC
SWCPLYGAATKRIVNISRTEDDVHLVHREMANGKQTKSVQVAEWMGRRDAWSAEKPPDTR
TKPTRWEFHDGREQLDEDVGRGQDIGEGDRRHIQSAEEQQRRVRIKHNRTAKDDLHLNFH
NSRTNLINDRDVYMEDVIENRDLAGDREHITRTRVNRQEYARRKQYDSEVRHIDDDSMRR
HEIDRGSDIDFNTAHNSLKSKRELFIKDGNVEILQLMTRDKTRDGLNLDDDNIYVNVPLK
PAGNLSHPQLLMVDNTGKEILMRRFIEEQPDGKQIIREHYQIVPGATYIQSMPNEVQQGS
TLKGDTFPLGKSGPNSIVYSQLEPEVKVIHTQPVQAGEGVSLDQQMQPAVSNQSLTHELE
HSLKQQNALLRQILMEKEKLENAYTQHEVALETQSLPGQSMAIGTQTDCDAGTQTEGFDG
VLDPEISLAKPSRRRARSENDESMSEDGYEYVRFNPPNSPEGVYWIKRRRTKKRPRQPRK
RIVMVEEVKRKIRTPIKEEEEVQERKKRVPPKKPLRETKTSILRKQLSDESRKDQSRNGE
SQTGNRHRSESDSHNRDMFMEITDSMDELASPGSHSIRKIQVEKYYKHSDGDFDEDDTEY
SIDSDGDEIVIRTNYPSRAQENERYRRQERTYAEPENPVDRKRPARKSSPTDSQPEAMPR
LSRRDSSKRGSRKQTSSEPPHNRVSISKYESTVTENGRKLMSTSTEIVGSKRSLTDRSYQ
SETELAGLEHEERNVPKYMEWYYNKKKSSVSGRTSTESSKSQPSSKKKVGAAEKRVSKTR
ITAQPKDVEEYDETGGRYKPEPAPRKSPPKGSRLLKEDRALNKQHKPKIETDTNHPLLQH
SEHRFERENALEVPAAPTKLPHYMYPETPPHAAAGGKESKSGRESKTSKEAKPKPSPIRE
NEVKVSNSKIYVEHRGTGHPTQKQLNASTLEDDHDSGIAMNSLLNSLGRRNPIAEKKSVF
SIAYDDVSRVKKINSGGESPQYS
Download sequence
Identical sequences A0A0B4K655
NP_001247031.1.81976 NP_788635.3.81976 FBpp0291145 FBpp0291145 FBpp0293205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]