SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293550 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293550
Domain Number 1 Region: 153-365
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.05e-48
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 2 Region: 780-1024
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000000322
Family Quinoprotein alcohol dehydrogenase-like 0.037
Further Details:      
 
Domain Number 3 Region: 355-459
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000431
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293550   Gene: FBgn0262562   Transcript: FBtr0305013
Sequence length 1101
Comment pep:known chromosome:BDGP5:3R:13594157:13602042:-1 gene:FBgn0262562 transcript:FBtr0305013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHNRENLRLSLLDLQATLTAPSQTVAAALLPQAPAHMQQLPSGSSSNISNSSSNTHSHS
SSNISACGSSSNINTGVSQAVSMATTTVARLSKAGFGAAAGSGGGAGSGYQNDKCDRLKK
MTSITCSDSEDDSERRAQFEISSKWNLGGYEGDTRTYVVQEIYRNEQSYVESLQTVVVKY
LKVLKAPEHAGMIDTRTVDEIFFMVPDILEIHEKFLSDLKSRLDDWDVQQKVGDAFMDTF
SKLEVLEVYTSFVNNCNRAKNAIRSMKHQRPSFSKFLETTAREHKGKLTLDNLLIKPVQK
FPNYELLFQRLIKHTDHDHPDTKHLQDVLKLVHDILVHINCKEREIMENGQREATLRELE
GVIEGITDLIAPERQFLLFDLVSMPSGQGARKDRGFFLFNDLLVLTSIKKRSGTIRKPNS
SICPGTVATTLDTNKYKFLTKISLDCLEIVKSKDENIKRIVSEIETLAEDCNKLQQITDI
TVTIKYPHQYLEDVIRELHREVQRQLSERQTNDTQLNMLELTVSSPNGNQKLAVVFSKTE
KRTQWEESFNEAKQKLAATLERHPIPEFLTSIPIRKTRAGLQFTCAAATLSDNRDVWVCN
SDGYVGQVCIMSLHPEPNVTSCNGVCNARILCVASVPAYSSAASSRNSSSEQPAGSGGQE
EKDKRHTPQSYTQQLRDYRKSISPSFQSASASATATPEKKKLTPTPTPVAGGEPADAATT
GGSDTQLELNLSSSDDETEAAAASLNVAGSTGSTLVERVPSPAPSYHGHQDSNPEEGESN
QSTMWIGTEDGCIHVYNSTDNIRIKKNRIKIEHHSAVYSILYLDNRVFVSLANGDICVYL
RDGATSWNTCSSHCLSIGTVTSPVNKLLNVNGRLWCSIQGIIKVLDVETLTVVNQIQISS
DSKPITNMTVSNNHVWISIQNSAHIKCFHSNTHQLVTEVNLAPAVNKMLSNCDEIIRQHK
AACLRVTSLLCCKDLIWIGTSAGVLLTIPAQGYEKGAINIVPTGIPHGHTGHVRFLTFVE
TTGLEGAASGAGGGRDAGSSNSDEYTKQGSIKHSKSKSETNNTLIISGGDGYEDFRNSGA
NSLSEIAGREDSTNHLLIWQI
Download sequence
Identical sequences Q9VEF9
FBpp0082955 NP_650653.1.81976 7227.FBpp0082955 FBpp0293550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]