SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293600 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293600
Domain Number 1 Region: 2778-2956
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.11e-27
Family Laminin G-like module 0.0067
Further Details:      
 
Domain Number 2 Region: 2582-2773
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.3e-26
Family Laminin G-like module 0.0047
Further Details:      
 
Domain Number 3 Region: 2397-2569
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000141
Family Laminin G-like module 0.036
Further Details:      
 
Domain Number 4 Region: 1065-1108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000893
Family Laminin-type module 0.007
Further Details:      
 
Domain Number 5 Region: 852-904
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000137
Family Laminin-type module 0.0044
Further Details:      
 
Domain Number 6 Region: 1150-1196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000206
Family Laminin-type module 0.0046
Further Details:      
 
Domain Number 7 Region: 1294-1342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000229
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 8 Region: 401-454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family EGF-type module 0.094
Further Details:      
 
Domain Number 9 Region: 1670-1719
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000109
Family Laminin-type module 0.0061
Further Details:      
 
Domain Number 10 Region: 1199-1247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000184
Family Laminin-type module 0.0062
Further Details:      
 
Domain Number 11 Region: 935-976
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Laminin-type module 0.0074
Further Details:      
 
Domain Number 12 Region: 1726-1775
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000134
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 13 Region: 1018-1059
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000206
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 14 Region: 974-1013
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000921
Family Laminin-type module 0.0056
Further Details:      
 
Domain Number 15 Region: 452-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000226
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 16 Region: 562-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000921
Family Laminin-type module 0.014
Further Details:      
 
Weak hits

Sequence:  FBpp0293600
Domain Number - Region: 1773-1814
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000642
Family Laminin-type module 0.031
Further Details:      
 
Domain Number - Region: 1247-1291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family Laminin-type module 0.014
Further Details:      
 
Domain Number - Region: 516-552
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family Laminin-type module 0.073
Further Details:      
 
Domain Number - Region: 1340-1392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00837
Family Laminin-type module 0.017
Further Details:      
 
Domain Number - Region: 810-843
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0187
Family EGF-type module 0.047
Further Details:      
 
Domain Number - Region: 224-285
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0644
Family APC10-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293600   Gene: FBgn0261563   Transcript: FBtr0305063
Sequence length 3001
Comment pep:known chromosome:BDGP5:2L:14263027:14326280:1 gene:FBgn0261563 transcript:FBtr0305063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIGNFIKWPLGLILILLVTHCQAKRQRKRLRGFSTAKDLQDYSMPLNDNSTELQQNIVS
WTGARIASSPDKKKKSPQSSRRHKTKSGLIIESNIADSESMLAIASSESVTKKKPPQRRR
NGKLQKSGGGAGGGALRLLKTEDVYSSSFSGGLYPPLFNVVPRAQISVNATCGQNGAEEY
CKQVGAKPCGICNAHSSDRAKQRSIQSLISSGSGSGSGSGFEEGWWQSPTLQGGRQFEYV
TILLDLKQTFQIFSVWLKSANSPRPASWILEKSLDGINFEPWQYFGLSDADCQRRWNLSG
QNGKYVFQNDTEIICSTQFSKPGPLENGVLHASLLKNRPGATDQSPELMKFITTRYIRIR
LQGMHSTANQDNSLDWLLDSPSLEKHSFYSLSQLKVSARLDCNGHANRSHESPDDPLMQC
ICQHNTCGAQCEQCCPLFQDRPYQMGGECEICQCYGHAESCTYDPFLDKGICQSCSNNTA
GIECEFCEMGFYRELDAPLTDPCLPCSCNPARSTGGCQSDGGSCNCLEGFQGKNCEECAP
GYYGDDCKRCECDERGSLGSTGSCSGVCQCKLNVEGSTCSECAPGYFDLSAENAEGCTSC
WCSGVSQTCHSAKLQTLAFETLNDWKITDIQRVKPISIPVDAETNRLIFANELDEVEAIY
WQASLGYLGNRLTSYGSRLQLVLSWDVIRGDRSGKPTTGPNVILVGKNGLKIAFGDESLD
GLGINLNVTLTEVGWYHVPPTVVDIKTRLRRTEGGDYHGESVTRSQFLSVLVSLDAVLIR
AAFHTDQGETSLERAVIYSGGVELGGKSSSQVEQCLCPAGYTGLSCEGCAFGFKRIYENT
SDHQILSKCIPCPCNGHSNSCDLQSGNCGDCMHNTFGDRCERCQLGYYGNPLQGTPNDCK
RCACPLSEDSNNFSPSCQLKSYNYMDLNPQFELIEHAEYICTQCPEGYTGDHCQVCDDGY
FGNPRQPGSSCQRCDCAGGPCNVTTGECITCRGNTEGWHCERCKLGYWGDPAVGCDPCHC
HTEGSESGLCDSTDGQCLCKPRYAGQKCDECDVGYANVELRCPSCNCDPLGSLVQDRCDP
HTGQCHCKEGVMGAKCHECQDGYFGMNAVAYRMDDLAALRQNSDSDDDEWELVPDTEDPN
SESTVACEECHCSSVGSLSSDCDKRTGQCACLANVTGRRCDKCRPGHWNLTAGEGCRDCR
CDPHGSRGHECNPWTGQCDCKIGVGGQHCNECTEGFFGFSTEGCQRCSACRSEGQVCDPH
NGRCICPKFTRGLGCGQCVPGTWGWQARLGCRECECDHIGSIGQQCSTGDGQCQCREGYS
GRKCDTCAIGYFGYPECRRCGCDAEGSFTQADGSIACDSNGQCPCKSLVVGLKCDTCMQS
TFGLSAQNPEGCTRCFCFGRSGECEQSDLSWGHIRMAESRNLSVQQIRPHSVPSSDYEYI
VVVQMEGSSFHREDAEIQRMNDLSLVPKSTGNVSIGAYGQFYHPLYFQLPPQFYGDRTSS
YGGFLYFTLITEGAHKPLERNILGQYPLVQLHAHSKLLLDFYEYEEFEYSLNVTHRVPLH
ESFWKYHHTSQAVDRNTLMAALQNIRHIFIRAFAFADFQEVVLQNVHMDAAIYIKGSTNL
IAKGVERCKCPKRFDGLSCQDPGRSFYRWRNTTIVESVFIEDLIGRAAPCHCNGRSSDCD
RETGVCQNCRGNTGGDHCHQCAEGFYGDPNSPHGCQACPCPETNRNFARGCNVWDGEVSC
VCKPGYTGRLCERCQAGYFGDPMRYPNTTCQPCNCHPDGIQTEGCDVETGRCYCREGVTG
LKCDKCQAERHHLVDNGCKICDNCTLLLLDYMELVGNKLRRGMHNMDLTGIPAPYRKLSE
YESAYEKWNGRHWDFSQTKRRLQDYDSADILKLEAHAENLKFQSRKAVATIGKREFAIKS
MREDAVTQQHSVGLLRSEILQTLSDLHGYGKSAHYLSLPTALKQARFYLQAIREHDQMVQ
GIRSTNDCAWKHFYAMGNASDASFDESGRLEMLWRDLNQTNHRVVDMRLQVDRVQEVENE
AEDVLEHVRNLSIRVGESHQELDELNQRISDHLDPGYLEQGEGLLRLTVQRQIMLNGHLN
QLDGYRILLNTTLGVKTEQQREVRKHWLPKAEKHASHLLARSNEYARKFQPTRNGARIAM
LASSAHSNITEAINDARLASILAKERVYEAQRTLYPSDGSSMIERAKHSLHRSKQLQQEA
LKQMHKSNVLKDKLHRQEQQVEGIKSTIYDSGLRTNNISGQLQGLSDGSARRQAKDSLEM
ADRTGEQMRAELQKAKDMQKSIQNMRNSFSNLEPDWEIKLGMAQENISLTQTNLRLANVS
LSYLEQQAEKEQQVFEVWNNSMAQQLQQLRDQIAKARHAAEAIDVSLESLGPKCIRSYLP
ASYGLSTSNKIRMSFALSNHLESSPLIHLASSEGRHITLELYKRRVRLVWNLGGTTATVT
HPMVVHTRDPKYDDAWYHVEANRTLNLGSLVVRRMNNYGELTPPNPVIITGSTDTEHTRF
YQSRSDRISLGGFASKDLQFTPGLNVVVHQVEVDNKPLGLWNFVTSEGSCGGSMVGAKES
SASSTARHFNGLGYAQLMKTRPRPTRKNLFSVQMTFRTLDENALLFLAVDDKNNRSVSVT
LSRGRIMFRIDYGDESKLEINTTKKYNVGQWIKIEAAREFSAKRSTENGMLRVNNDRPIS
GAPTLPVNIHLLPDLSKTVYYLGGVPPGFTSGTSKAPGADNPFLGCMKDVQVNGETYDPL
ESSSYYGVEPSCKNMITKAGFSGNGYLELPSQSLRKRSNTALVFRTLQPDCLLLLAAYPP
EILGDYDAKDIKGNFSISLVDGQLHVWVNSGRSFIKMSSNSSQMNDGEFHVVHLIKTGRK
LELMVDDELQEIRNLNGNPTVVSLPRDAGGLYIGGAPPHESYTPLAPTFVNLEGAIRDVV
FNNRTINFNDALTFANVQIGRNGPLMGSLKGGLYDVLLKTEPMIGKSFTASPEGCKRDFS
C
Download sequence
Identical sequences R9PY40
NP_476790.3.81976 FBpp0293600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]