SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293888 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293888
Domain Number 1 Region: 98-276,312-368,738-852,984-1021,1092-1221,1303-1323,1376-1424
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000921
Family HEAT repeat 0.085
Further Details:      
 
Domain Number 2 Region: 586-688
Classification Level Classification E-value
Superfamily Sec7 domain 0.000068
Family Sec7 domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293888   Gene: FBgn0029834   Transcript: FBtr0305345
Sequence length 2051
Comment pep:known chromosome:BDGP5:X:5934350:5944414:1 gene:FBgn0029834 transcript:FBtr0305345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDLFLLIIKESTGTKHNALRQTAQIAYDKLYRQHGIHRDPSHELRSVCFTALQMALDTK
RPKFITMGLNGLHRVIKDERFYIGLEPEDDSVWLPSQLLRATNGILPTTSSEDTVVNVLR
LFLAMACSPACTLNGRLLIEILSRCGECWEMGSRATKAASLAAASQCLRTFCAFLIEEAE
EVKKTAPAGLMTQTQASAVYNEVIPVMQWLCSRLVEPNVNASPNKKCENHSSLYLTECIL
TLSSALPRNVHANPHFTSFLWQKFCPTLAAALGSPGRINLDKKFTYKDALHMIENEARGF
FTGPGLDGPQARCVYLTAIQLLRIAGAHGSLRPMLEALFHRMLLLPAPQNRTEPLRCVRE
IFKSPERLIDLAVILYVDKNTAQGCSDEMALFRLLVDAMEECAYGASGGGSATEASLQAS
VECMVALLDSLQVLCSGELTESMISDQIVQVVNGRHDLLKDADYSGPLTYQSMARLPAPY
RDAIVEFRQTVFETSSGSESEGEPQHEQDAASNGSGDTEGPEDDDPSSSSDETSRVENRW
PYSHLEAPVMPIRTDSDNDRQHARDFARALRQDLVPKLLRLRSCVELDEAMQEFASAVCQ
ENSMNFSDFDYNLTAINADGIYLAIYSSLLLSLQLMRAGFYEQVAQGMSHKDILVPMSEQ
QFVTSVQNTGVLVYLSSPWLCELYQSVTVCNVLEAMPRQQLEGMGPRCALVDMLCDAGGL
GATQMLSEWQRLQTANVKHKEEEQLHDKRREAAKKLCRRLLTCCWDSMVIVLSSGLGDLQ
TSSASNKLVALSKRTLRVKAKANKSNGEALYAMCLDGLHSAATLSNSLNLQHLAGKILNL
LASNVCQTSGPRISASQAMSMDVVLTGGLNLGSYSADCWPSIFAVCRHVSQLEHEIFSMQ
NPAISASPGSSRRDLETGEKLSNGNAQDKLNLSSIPIDDDETCVDVYSFLQAPMQSPNTN
ITSILKVYSGTNETVLLSQSDTSKVLCALSHQAENLFGDAAERLSLPSLCQFLKHLCRAS
RDQLYKSQVARKGSRIWWPSKGWKKLDSLPMSLLLHRIGDVTLKVFRSSRPLLHVLKVWA
ITGPHLMDAACHRDRMISKRAIEYIHDIITALLVEQSELPYFHFNEALLKPFENLLSMDT
DVDVQDQIVACLYEVVEAHRTEIRSGWRPLFGTLRNARSRMLNMSNIIDIFRVFLDSDNT
LVFANAGLDCILCLLSYLEISGGGNNNACSGGSGSAAGGTASNGGQQEEDNTFRPTDFLH
ETLRFLERCSSILGFMHSMPKCPNFHSTYKIKGISYTHIIDANIPSSMENFTYFGNDYLQ
TRNEQYMISYRSLHIDKDTIVKIDEMDKPSGVLKVWFLLLDGLTNSLIVCPYSHQAPILQ
TIFKLFKNLLASPGIDFGFYCINHLLVPMIQDWLRYINKTGSSWQLVEKNFKHCCCMTTD
LVVEFIEKSVPEQRRLGAGTKTRLAQIVHPADNLLYSKLKFVTERIEREQQQQQSPSVQD
HGCGYTQQYDSSSSSASEEQQKNGGGVGGGGSNLIESPTKISGSATLALKQLLLVLIECA
AQSQEAIARISVSCLKHVILSTGMLFNESQWMIACSAIHRACTVTIAPLRQLSFAFHEKS
NSFYGDCANVKVAARRDSSLEELARIYALAQQVFLSDNQREPGQNQAPTPSASQCKLSDD
RSYSFLLYPLNNGFNSNLDNFVIRIPFKNLVVGLLANQMLLQLVAKLLLSRLKCVPQAVS
TCIFDNYAASAASPSHDYDLDFRSKEILLRCVKQYLMSALEFDSRPGLKFLMQKVSNIEY
AANLYKQMTSSWMIYYIALVDSHLNDIVVYNLGPEDLNFILESCSRLNTTTVKKKENFVR
YLFCLQDAWNLVCELYLSNSALHEIESGSGKLRQKPPQLLHHPQTKPMCISLNGNGDAEM
TDTGSGSGSGSSTSPSKCVQLQEEENVTMTTLISEFQPKCRSNPFDTNRQAKSSEAESIS
PEIEQQRASSILKDSNYKRAALAQLVVASMELLRSLPGEAEENLKLLMTPTIREAFRLVQ
LQGNELKVNQF
Download sequence
Identical sequences Q9W444
FBpp0293888 NP_001096888.2.81976 NP_572289.2.81976 FBpp0293888 FBpp0293889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]