SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0297109 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0297109
Domain Number 1 Region: 408-486,535-633,710-841
Classification Level Classification E-value
Superfamily TPR-like 6.64e-26
Family Tetratricopeptide repeat (TPR) 0.0074
Further Details:      
 
Weak hits

Sequence:  FBpp0297109
Domain Number - Region: 86-185
Classification Level Classification E-value
Superfamily TPR-like 0.00721
Family Tetratricopeptide repeat (TPR) 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0297109   Gene: FBgn0021847   Transcript: FBtr0305967
Sequence length 851
Comment pep:known chromosome:BDGP5:2R:2097287:2101623:-1 gene:FBgn0021847 transcript:FBtr0305967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANKNMRNTTTKVEALIESCRSEGKWHRVIELTDELKTGSPHNECLANFLVGEARLESYL
EENALASDSNFGRAKSGLAEARRFLHLALGESGQKAGIALDAYLLLAKLCFACGEYEQSL
DNFVKAELNTLAEKELTLRSLKILAESYAIKGLCLEQQTTKPSSKFKKAEKDTEMISCFE
RASDLGLLYLQEYDLVSGSSGSSNNSTAGSTLNVNASTVQPSSSSFAISSTIPASGPSGL
EMNRRMGAILETALQRAPIVLIKTEKLQEAVERYRIMLNAIETRATQSLRLTLARQLAEV
LLRGVSGTIYSPPFTGKSGGGTLRGGSSKKLWKPRKYAARQQFNPRNQQEEVILLLLIAE
ALAVRDTVLSQSPEFRQARQHAMGNVTAVYDLLTLATVRWGLVQLLNESFEKALKFSFGE
QHVWRQYGLSLMAAEKHSHALRVLQESMKLTPSDPLPCLLASRLCYESLETVKQGLDYAQ
QALKREVKGLRPSRSQLFVGIGHQQLAIQSNLKSERDACHKLALDALERAVQFDGNDHLA
EYYLSLQYALLGQLAEALVHIRFALALRMEHAPCLHLFALLLTSSRRPREALGVVEDALH
EFPDNLQLLHVKAHLQLHLEDAETALGTVQHMLAVWRDVYEAQLAGEEEKHSDTKSGVHL
AHSSQMSDKDSISRVEQALSEAASSLSSFTQRPGPRRPWMLQIEIWLLLADVYLRIDQPN
EALNCIHEASQIYPLSHQIMFMRGQVHVYLEQWFDAKQCFLNAVAANPNHTEALRALGEA
HLVLGEPRLAEKMLKDAAKLDPSCPKIWFALGKVMEILGDFHASADCFATSLQLEPSCPV
LPFTSIPLVFE
Download sequence
Identical sequences A0A0B4K7H0
FBpp0297109 NP_001246147.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]