SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0297245 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0297245
Domain Number 1 Region: 392-463
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000431
Family Ankyrin repeat 0.0035
Further Details:      
 
Domain Number 2 Region: 553-653
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000126
Family Fibronectin type III 0.0069
Further Details:      
 
Weak hits

Sequence:  FBpp0297245
Domain Number - Region: 1454-1537
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000465
Family Ras-binding domain, RBD 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0297245   Gene: FBgn0039000   Transcript: FBtr0306108
Sequence length 1553
Comment pep:known chromosome:BDGP5:3R:18499891:18507898:1 gene:FBgn0039000 transcript:FBtr0306108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRKALSSYAKFKDQQEAAAAVTPQKDNESDDSLPALRRSHSVRSSLRRLKNKLHSPAL
SMQSPFKLRTQLHMRNRSSRGSATLDKSKAAKALRMLGDLDAVAVLTTKVKGKNEFVPLK
RAMNSDSCDHDELGIERLMSSLPVGAKLPRKACKLLQIPESYCRQAEVAPKATLDSDLEK
TFSGEESSAVLADITRHAQQGIYGTTRMRTATIRKPMPYLNSHNILPQDKRDGDIDSVRL
REKVVNPSGGNNNNQDNYPTYYPAPLLSTSRWSEQLTQHAAVAKIRTAISCHSQDLREME
FLLPHSRTDSQSNSQSQLCISRHSQPKNAKLRDDHDETGSSELDSPPLGDENASANGQLS
VHRQPVQLRSKIPGNTPHPRASKMSKKQLKLAQAQLDKLTQNNLHLHALFSAVEHGHLEK
ARTILESTDVDVNSINNDGLSALDLAVLSNNRSMTRMLLQHGAVEGSQFSVDTIGTKLNG
LLKDAESRIHDLSGPEGLCPPVFASRPSISSIIIGNSSASVTGCTGSEVEKQIGIWERRV
KGLRRLQLGWDQARPPDAPASVVVDVTGDNSISVQILEPFEGAIGTKFKVQWSTRADFNN
VVGESELLEWISFHGTMGAQCHISGLTQGRRYFLRAACGNVKGWGTYRTSVPASVVPSTW
RDLDNREDRFVGRHRILDNLFTAVRLARPADVSELTLDPASAQRRNPKKKTTIKQLFSVT
TKFQKTLRRGIYFSCIIHCDDKVLVTSEDFPPVIEVDESYPSALHMDYYWLMKVACTWED
VKSLRSDMERNLTSAVHFRTKLLSAVCQMQSALGITDLGQLYYKPLRDAQGTVVLTCVQS
VKSQKAVSILNSRWVPVSKLQKKLGALHEDYTINELLISSIGDQLHYQQAALQRLEPGLY
LGYLKMQCSIDQIQVVVPVKTPNVLPHCKVRENSHITAEEWQVLHRYSSDPLRLPLDFSA
QGGDGASGATATTEVQRLFLYDLTNAMHKLFASMNIKIADATTHRLYDVEVIEHSPDISF
LVVCPSAESSCAVPGQSELLLQRDDLASLSIQAFEMIHLRTYQPAIIQKYARLSCILELD
TALATHSLREAFSSSELQAAKERLATLQELSASLTIVWKSVRWLMDVVAYARNKNAQPSL
AMREILDFAQQRQDEAVATSAGGSANKQLLQLPIRESKFSKTGQGRGSWPGPGTSEDQSQ
NKPEHSKSEQNLELSAITPVEPASNQVPTQQQQPQQQSQQQQLLQVSNISEYAGSICSEV
SFRKNSGDSMSSTYTSRSFYSAVDSASDGNSTNSVFAIPPSRSDDTLADALRHSQAVAAQ
RKRTSSNIASHTNPLITVHSSSSAPYLAGSSVSLRSGNGAFATDLEHKPLKPATKAASSA
NLREGGPYLKSTLAELRAVGGEEPVASTSKASSMKSLSRQSSEEDSASCSSLNAEQTSGI
IQVYTAYSTGLASGTSLKIHVTPKTTAREVINLVVKQLNMAVVLKGNNGPIYGPEMLENF
CLVAVIGARERCLRDDFKPLQLQNPWKKGRLYVRKKHELLAAIEHSNRKSHLI
Download sequence
Identical sequences A0A0B4K6W6
FBpp0297245 NP_001247243.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]