SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0297558 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0297558
Domain Number - Region: 18-46
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0487
Family CCCH zinc finger 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0297558   Gene: FBgn0261642   Transcript: FBtr0306603
Sequence length 789
Comment pep:known chromosome:BDGP5:2R:13153023:13252891:1 gene:FBgn0261642 transcript:FBtr0306603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANVVNMNSLLNGKDSRWLQLEVCREFQRNKCSRQDTECKFAHPPANVEVQNGKVTACYD
SIKGRCNRDKPPCKYFHPPQHLKDQLLINGRNHLALKNALMQQMGIAPGQPVISGQVPAV
ATNPYLTGIPANSYSPYYTTGHLVPALLGPDPVTSQLGPVVPQTVQVAQQKIPRSDRLEQ
FSGMVPFKRPAAEKSGIPVYQPGATAYQQLMQPYVPVSCIINAVMASTNITSSATTTASS
SLLSALGTPPTTTTTAITNPNDSDNDSDRNQDHDKNHDSTADGEADNADRNDAIDQVSNQ
DNSDQVNLNQNQQNSSPAKDCNTTRTISPNPQDTAATAATATETDTLDTESAAAAAAATS
ATHPPGDTPPPCQRSPQGDSLLPLPNGLGDNNNYLSYINNNLNNGQLKSANPEELNGGDL
ESSSNNAAAAAAASASASRNYAKQNGEGYSRYMVNGHSTGILPTPTTSAPAVSYQAQAQA
QAQAQVQAQAQAQAQVQAQTQQRINYAMSAYGNLYSHYGAPTSAMVSLPSSTPSYAQAQM
QQQQQQAQAQAQAQAQAHAVYAQQAYAAYAAAGLAPQATATGSYYADPAALAKEVAQKNY
AMKLASAGTKPGVSSAAAAYTGLTLNKSYVAAAAGAQPVQPAQHQAVSMATLLQMQAQAQ
AQAAQVQAQAQAQAQAQAQAQAQAQMRQLGSLPSSGLATPVPGTPVRAPVGASQYQSATL
LRAPSPMPYAQPQSYFYPGMMPTAAYAMPQTQAAAAQQYAAAAAAAAAAQAGTPGSAMVL
NPYKKMKTS
Download sequence
Identical sequences B7YZJ0
NP_001137688.2.81976 FBpp0297558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]