SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0300162 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0300162
Domain Number 1 Region: 378-402
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000968
Family CCCH zinc finger 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0300162   Gene: FBgn0051601   Transcript: FBtr0307507
Sequence length 726
Comment pep:known chromosome:BDGP5:2L:22040727:22043787:-1 gene:FBgn0051601 transcript:FBtr0307507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHSDGNEEKVTSLTKRNPGNLYFNLENTQLEGDDEKAFRYTKRNGHHSMAAAASSVSLG
ITEPTEASQDITNYWMEYCAANENARSLCSGDVTSSSLSKNLSVRKAVPQSSSPQSNFVY
KPFDYTLHGLTDFESTMSSARMSSSQSSELFRKENYRFENSATGLDDDSNDILSSTMKDP
QDILSFFSDECEIDNLDSLKKNKNPQNRPAKFTITAYKDIGKDNLSDFEVTNLIDGSHKN
IYIGATQYKLKAQQNQVQPVDKGFCVKVSKEGSDQQQKNNILEPGELSEDDTSESQKVRC
DYKTSDMEDGEVSCEDFDAPPNLIKKKSLCQFDNTSFEKKNVSVDKKHDPVESVDLEDGE
LFGEDNEVSSNTIKKEDNRMPICRYHIRNCCIWGQNCRFRHPNLNRLGKYVMFEKKCLPV
PTVTFPPVWSTCVLPAKDTYPMEVIEKMSRMPKSLEISFGMNNMDNDPYYTQNEPEVNKR
APLLPTPTISELLAEQKQYHNSLAGNRPVRTSRYSRNLRSTQANGTSFLTCLEKRDRSPR
LPRYSARKNQQPQISLGNIRRPSGIIVRPKPKRQRLSDSTFSSTDSSESSSYESTTESTD
DISSFSESDGRGQKNSSSLLGILIKNMKRNEEKFSSDADARFTTKRPNYSKFRNQKQTLS
KLSTKTPVRNPPNVLPNAPKKPHSVLESSNSIKKKQDRQKYLLMQLLRVEQQIEKKKKHR
MKAFKE
Download sequence
Identical sequences Q8IMF0
NP_001246130.1.81976 NP_724371.2.81976 FBpp0300162 FBpp0300162 FBpp0300802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]