SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0300426 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0300426
Domain Number 1 Region: 215-392
Classification Level Classification E-value
Superfamily MIR domain 5.49e-39
Family MIR domain 0.0031
Further Details:      
 
Domain Number 2 Region: 1086-1212
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.8e-21
Family SPRY domain 0.023
Further Details:      
 
Domain Number 3 Region: 665-801
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000459
Family SPRY domain 0.057
Further Details:      
 
Domain Number 4 Region: 98-182
Classification Level Classification E-value
Superfamily MIR domain 0.000000209
Family MIR domain 0.025
Further Details:      
 
Domain Number 5 Region: 4195-4257
Classification Level Classification E-value
Superfamily EF-hand 0.000000471
Family Calmodulin-like 0.032
Further Details:      
 
Domain Number 6 Region: 2237-2335
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000392
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 
Weak hits

Sequence:  FBpp0300426
Domain Number - Region: 452-630
Classification Level Classification E-value
Superfamily ARM repeat 0.00719
Family GUN4-associated domain 0.072
Further Details:      
 
Domain Number - Region: 1532-1657
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0261
Family SPRY domain 0.03
Further Details:      
 
Domain Number - Region: 2293-2423,2629-2801,3274-3420
Classification Level Classification E-value
Superfamily ARM repeat 0.0921
Family HEAT repeat 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0300426   Gene: FBgn0011286   Transcript: FBtr0308083
Sequence length 5115
Comment pep:known chromosome:BDGP5:2R:4747869:4775602:1 gene:FBgn0011286 transcript:FBtr0308083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAEGGSEQDDVSFLRTEDMVTLSCTATGERVCLAAEGFGNRHCFLENIADKNVPPDLS
QCVFVIEQALSVRALQELVTAAGSETGKGTGSGHRTLLYGNAILLRHHNSDMYLACLSTS
SSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLHTTKE
NEQSIVNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSTWGREAG
QNIVIYEGGVVMAQARSLWRLELARTKWTGGFINWYHPMRIRHITTGRYLGVNDSNELIL
VKKEEASIATTTFCLRQEKDDEKKVLEDKDLEVIGSPIIKYGDTTVIVQHCETSLWLSYK
SYETKKKGVGKVEEKQAILHEEGKMDDCLDFSRSQEEESKTARVIRKCSSLFTQFITALE
TLQSNRRHSIFFQKVNLNEMVMCLEDLINYFSQPEDDMEHEEKQNRFRALRNRQDLFQEE
GVLNLILEAIDKINIITSQGFLASFLAGDETGQSWDLISTYLYQLLAAIIKGNHTNCAQF
ANSNRLNWLFSRLGSQASSEGSGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEKHGRD
PKVLDVLCSLCVGNGVAVRSSQNNICDFLLPGKNLLLQTLLVDHVASIRPNIFVGRVDGS
SMYQKWYFEVTMDHIEQTTHMMPHLRIGWANTSGYVPYPGGGKKWGGNGVGDDLYSFGFD
GAFLWTGGRKTLVVDALPEEPFIRKGDVIGVAIDLSVPIITFTFNGVKVRGSFRDFNLDG
MFFPVMSCSSKLSCRFLFGGDHGRLKFAPPMGFSALVQCLMPQQILSLDPCFYFGNLAKN
VLAGPWLIEDDTAFVPKPVDTTGVTLPSSVDQIKEKLAENIHEMWALNKIEAGWSWGEHR
DDYHRIHPCLTHFEKLPAAEKRYDNQLAVQTLKTIISLGYYITMDKPPARIRPVRLPNEI
FMQGNGYKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSENHRS
PHLVPYAKVDEAIKKANRDTASETVRTLLVYGYVLDPPTGEGTEALLAEAQRLKFAGFRT
YRVERNYAVTSGKWYFEFEVLTSGPMRVGWARADCYPGAMLGSEDTSWAFDGHNVTKMHA
GSIEHFGVRYEAGDVIGCFIDVKEQTISFSLNGELLMDALGGETTFADVTAEGVGFVPAC
TLGVGQKARLIYGQDVDSLKFFTTCGLQEGYEPFCVNMRRPVTHWYTKDQPIFENTEEMP
DCRIDVTRIPGGADTPPHLKISHNTFETMEKANWEFLRLSLPVTCMGEFISEQEKARRWD
EIKNRQYRLMREAEIAAQMQVQTQAAHMDHMLKGGFNMNDIKGLTRNFDEHADAEADHMM
RGPNRPPRKGSLTRNITFETDMSAALDEMQRSTSVLDMNGLGEEMDDKKKRGRSPFKFFS
KKSRDQSREKMGARTLDTSLERRNTVAHGRNVVNQQMTTRAPTLRLNNAEIPPSPVPQGP
KQLSGSNLGQQPVETSGDEMFDAECLKLINEYFYGVRIFPGQDPTHVYVGWVTTQYHLHS
REFNKNKVRRGSVYIEDDYEMAIERIDRQSCYVVRADELFNEVTQDASGKGASQGMFVGC
FVDTATGIIRFTCEGKDTSHRWMMEPDTKLFPAIFVEATSKEILQIELGRTPTTLPLSAA
VLPTSDKHINPQSPPRLKVQCLRPHQWARVPNTALQVHALKLSDVRGWSMLCEDPVSMLA
LHIPEEDRCIDILELIEMDKLLSFHAHSLTLYAALCYQSNYRAAHALCQHVDQKQLLYAI
RSEYMSGPLRQGFYDLLIALHLESHATTMEVCKNEYITPLGAELKELYSDEEMQHSLRSL
VTESVRPQLRMTEITEPIPDIDQLYSPKFPLEVVRQFVMEALKDAVEINQVHNRDPIGWT
NENLFLPLIKLTDRLLLVGVLTDEDVQRLLVMIDPETWDQAFEREGKDEHRKGLLTMKMA
EGAKLQMCYLLHHLYDTQLRHRVESIIAFSHDFVGDLQTDQLRRYIEIKQSDLPSAVAAK
KTKEFRCPPREQMNQILCFKNLEPDDQDNCTCGLELRGRLGDFHDSLMQKVSLNALQEPD
GVEGTAIEEVKTGPITKIYNFINTVKELEEGPKEVEEPEKKTPEEVFRKVLIKTIVSWAE
ESQIENPKLVREMFSLLLRQYDTVGELVRALEKTYVINTRARDDVAEMWVGLSQIRALLP
VQMSQEEEELMRKRLWKLVNNATFFQHPDLIRILRVHENVMAVMMNTLGRRAQAQSDAPT
QSEVAEGAPSKEKDTSHEMVVACCRFLCYFCRTGRQNQKAMFDHFDFLLDNANILLARPS
LRGSTPLDVAYSSLMENTELALALREHYLEKIAVYLSRCGLQSNSELVEKGYPDLGWDPV
EGERYLDFLRYCVWVNGESVEENANLVIRLLIRRPECLGPALRGEGEGLFRAIVEANRMS
ERISDRCKMQDEAEGTIAGLNFTHPLPEGEEDEDYIDTGAAILNFYCTLVDLLGRCAPDA
SVIEQGKNESLRARAILRSLVPLEDLQGVLSLKFTLSQTAPGEEKPKSDMPSGLLPNNKQ
SIVLFLERVYGIEAQDLFYRLLEDAFLPDLRTATILDKSDGSESDMALAMNRYIGNSILP
LLIKHSKFYNEAENYASLLDATLHTVYRLSKNRMLTKGQREAVSDFLVALTSQMQPAMLL
KLLRKLTVDVSKLSEYTTVALRLLTLHFDRCAKYYGSTQGQGSYGASSDEEKRLTMLLFS
NIFDSLSNMDYDPELFGKALPCLIAIGCALPPDYSLSKNTDEDYYGRQMGAPDQPQYMPN
PIDTNNVHLDNDLNSLVQKFSEHYHDAWASRRLEGGWTYGDIRSDNDRKHPRLKPYNMLS
EYERERYRDPVRECLKGLLAIGWTVEHSEVEVALNHRGSTRRQSKPQINEGSPFNYNPHP
VDMSNLTLSREMQNMAERLAENSHDIWAKKKNEELNGCGGVIHPQLVPYDLLTDKEKKKD
RERSQEFLKYMQYQGYKLHKPSKGGAVEEGGATQAAVELRFSYSLLEKLIQYLDRATINM
KLLKPSTTFSRRSSFKTATRDIKFFSKVVLPLMEKYFSTHRNYFIAIATATNNIGAASLK
EKEMVASIFCKLAALLRNRLSAFGPDVRITVRCLQVLVKGIDARTLTKNCPEFIRTSMLT
FFNQTSDDLGNTILNLQDGKYSHLRGTHLKTSTSLGYVNQVVLPVLTAMFDHLAACDYGS
DLLLDEIQVASYKILAALYHLGTDGTLTHDRKYLKTEIERHRPALGSCLGAYSSCFPVAF
LEPHLNKHNQYSLLNRIADHSLEAQDIMVKMESCMPNLETILAEVDQFVESDKTYNDAPH
IIDVILPLLCAYLPFWWSQGPDNVSPTSGNHVTMVTADHMNPLLRNVLKMIKKNIGNDNA
PWMTRIAAYTQQIIINTSEELLKDPFLPLAERVKKRTENMLHKEDSMRGFIKSATDDTSQ
VETQLQEDWNLLVRDIYSFYPLLIKYVDLQRNHWLKDNIPEAEELYNHVAEIFNIWSKSQ
YFLKEEQNFISANEIDNMALIMPTATRRSAISEGAPAVGGKVKKKKKNRDKKRDKDKEVQ
ASLMVACLKRLLPVGLNLFAGREQELVQHCKDRYLKKMPEYDVIEFARNQLTLPDKLDPS
DEMSWQHYLYSKLGKTEEPVDEQALEKANVNSNEKGKDKTQETVDRIVAMAKVLFGLHMA
ASSKNRSKRWGSKISVARRQAVISSLRAKHLYRMSRHRACNIFARSYYEQWLQEENVGQE
VMVEDLTQTFEDSEKSKKEGEETDSKPDPLTQLVTTFCRGAMTERSGALQEDLLYMSYAQ
IAAKSTGKEEEEGGDEEGGEGGEEGEGTSIHCRMRQLMEQEMEKQKLLFHQARLSNRGVA
EMVLLHISASKGIPSEMVMTTLNLGIAILRGGNIDIQMGMLNHLKEKKDVGFFTSIAGLM
NSCSVLDLDAFERNTKAEGLGVGSEGAAGEKNMHDAEFTCALFRFIQLTCEGHNLEWQNY
LRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKEIIDPAGKANFFKAIEVASQVF
NTLTEVIQGPCTLNQQALAHSRLWDAVGGFLFLFSHMQDKLSKHSSQVDLLKELLNLQKD
MITMMLSMLEGNVVNGTIGKQMVDTLVESASNVELILKYFDMFLKLADLIESPSFHEVDM
KNEGWVTPKDFREKMEQSKNYTPEEMDFLLACCERNHEGKIDYRAFVEHFHEPSKEIGFN
LAVLLTNLSEHMPNEPRLARFLETAGSVLNYFEPFLGRIEILGSSKRIERVYFEIKDSNI
EQWEKPQIRESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMTHASGLMATDDGGGNVK
RDTAYSSYMSEEEEERAARDPIRRTITAVKEGLKFGVHMLSPANIKHQIGVMQTKSIPEL
IVGFFKIIFYIFYYTGYAHFCVVRYIFGILLNLMRGPAPEQEEEPVVEEETFGRALPPLP
LEEPPGTVQAFGLDINKEENGMYKVVVHESPANSSMEEGGESSPEDGAAASGELVEGEPH
QEPISIVDLLGGEAAKKAAQERQEAQKAQEAAMASIEAEAKKSSSAPQETPAVHQIDFSQ
YTHRAVSFLARNFYNLKYVALVLAFSINFMLLFYKVTSFTEEADSSAEEELILGSGSGGG
ADITGSGFGGSGDGGSGDGEMEDEIPELVHVDEDFFYMEHVLRIAACLHSLVSLAMLIAY
YHLKVPLAIFKREKEIARRLEFEGLFIAEQPEDDDFKSHWDKLVISAKSFPVNYWDKFVK
KKVRQKYSETYDFDSISNLLGMEKSTFAAQESEETGIFKYIMNIDWRYQVWKAGVTFTDN
AFLYSLWYFSFSVMGNFNNFFFAAHLLDVAVGFKTLRTILQSVTHNGKQLVLTVMLLTII
VYIYTVIAFNFFRKFYIQEEDEEVDKKCHDMLTCFVFHLYKGVRAGGGIGDEIGDPDGDD
YEVYRIIFDITFFFFVIIILLAIIQGLIIDAFGELRDQLESVKDNMESNCFICGMGKDFF
DIVPHGFDTHVQKEHNLANYMFFLMHLINKPDTEYTGQETYVWNMYQQRSWDFFPVGDCF
RKQYEDELSGGGGGG
Download sequence
Identical sequences A0A0B4K715
NP_001246206.1.81976 FBpp0300426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]