SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0300656 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0300656
Domain Number 1 Region: 313-371
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 2 Region: 369-425
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000023
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 3 Region: 432-472
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000017
Family Laminin-type module 0.016
Further Details:      
 
Weak hits

Sequence:  FBpp0300656
Domain Number - Region: 99-172
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00765
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0300656   Gene: FBgn0015773   Transcript: FBtr0308337
Sequence length 667
Comment pep:known chromosome:BDGP5:X:14498045:14547864:-1 gene:FBgn0015773 transcript:FBtr0308337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRGILLLLLGTTRFSPIQCISNDVYFKMFSQQAPPEDPCYNKAHEPRACIPDFVNAAYD
APVVASSTCGSSGAQRYCEYQDHERSCHTCDMTDPLRSFPARSLTDLNNSNNVTCWRSEP
VTGSGDNVTLTLSLGKKFELTYVILQLCPHAPRPDSMVIYKSTDHGLSWQPFQFFSSQCR
RLFGRPARQSTGRHNEHEARCSDVTRPLVSRIAFSTLEGRPSSRDLDSSPVLQDWVTATD
IRVVFHRLQRPDPQALLSLEAGGATDLASGKYSVPLANGPAGNNIEANLGGDVATSGSGL
HYAISDFSVGGRCKCNGHASKCSTDASGQLNCECSHNTAGRDCERCKPFHFDRPWARATA
KEANECKECNCNKHARQCRFNMEIFRLSQGVSGGVCQNCRHSTTGRNCHQCKEGFYRDAT
KPLTHRKVCKACDCHPIGSSGKICNSTSGQCPCKDGVTGLTCNRCARGYQQSRSHIAPCI
KQPPRMINMLDTQNTAPEPDEPESSPGSGGDRNGAAGMAAQSQYYRTEGGRGKMRQMQSQ
HQKAKPKQVLQKRLRNNGQSNWSRYEQRGGQQGSSTARNGSRRGGLRNGSGAAGIGPISD
HGGVRVSGGGLSQSQSQSQRQRNGALRSADPGRLQAQQARRKQRRGERVRNAEYNPKTRS
YDLDHTD
Download sequence
Identical sequences M9NF48
NP_001245667.1.81976 FBpp0300656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]