SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0300832 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0300832
Domain Number 1 Region: 71-176
Classification Level Classification E-value
Superfamily TPR-like 4.8e-33
Family Tetratricopeptide repeat (TPR) 0.0004
Further Details:      
 
Domain Number 2 Region: 515-709
Classification Level Classification E-value
Superfamily TPR-like 6.17e-33
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 
Domain Number 3 Region: 314-514
Classification Level Classification E-value
Superfamily TPR-like 4.88e-31
Family Tetratricopeptide repeat (TPR) 0.0051
Further Details:      
 
Domain Number 4 Region: 882-1075
Classification Level Classification E-value
Superfamily TPR-like 5.42e-31
Family Tetratricopeptide repeat (TPR) 0.0052
Further Details:      
 
Domain Number 5 Region: 721-875
Classification Level Classification E-value
Superfamily TPR-like 9.21e-22
Family Tetratricopeptide repeat (TPR) 0.0083
Further Details:      
 
Domain Number 6 Region: 1043-1192
Classification Level Classification E-value
Superfamily TPR-like 2.85e-16
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 
Domain Number 7 Region: 209-306
Classification Level Classification E-value
Superfamily TPR-like 0.0000000062
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0300832   Gene: FBgn0262719   Transcript: FBtr0308608
Sequence length 2523
Comment pep:known chromosome:BDGP5:3L:8465907:8500246:-1 gene:FBgn0262719 transcript:FBtr0308608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTNYENIINLPLNFNANNHAAGNNENNAKIAIVGEQLLNKMSQRDFSENEPECTPELPAA
NRALFLEKVRQSNAACQSGDFATAVLLYTDALQLDPGNHILYSNRSAALLKQGQFTAALQ
DATQARDLCPQWPKAYFRQGVALQCLGRYGEALAAFASGLAQEPSNKQLMAGLVEASLKS
PLRAALEPTLQQLRTMQLQESPFVVSSVVGQELLQATQYSAAVTVLEAALRIGSCSLKLR
GSVFSALSSAHWALNQLDQAIGYMQQDLAVAKSLGDTAGECRAHGNLGSAYFSQGAHKEA
LTAHRYQLVLAMKCKDTQAAAAALTSLGHVYTASGDYPNALASHKQCVQLFKQLGDRLQE
AREIGNVGAVYLALGECEAALDCHSQHLRLARKLHDQVEEARAYSNLGSAHHQRRQFTQA
AACHEQVLRIAQALGDRSMEAAAYAGLGHAARCAGDASASKRFHERQLAMALAARDKLGE
GRACSNLGIVYQMLGSHDAALKLHQAHLGIARSLGDRTGMGKAYGNMARMAHMAGSYEAA
VKYHKQELAINQAMNDRSAEAATHGNLAVAYQALGAHDAALTHYRAHLATARSLKDTAGE
ACALLNLGNCLSGRQEYEEAVPHYESYLMLAQELGDVAAEGKACHLLGYAHFSLGNYRAA
VRYYDQDLALAKDAQHRPNMGRAYCNLGLAHLALGHTAAALECQQLFLAVAHATNQLPAK
FRALGNIGDILIRTGSHEEAIKLYQRQLALARAAGDRSMEAAACGALGLAHRLMRRWDKA
LGHHTQELTLRQELGDLSGECRAHGHLGAVHMALCSWTNAVKCYQEQLERAQEQRDAAVE
AQAHGNLGIARLNMAHYEAAIGCLEAQLGTLERVSLPSTQADRARALGHLGDCYAALGDY
EEALKCHDRQLQLALGLTSHRDQERAYRGLGQARRALGQLPAALVCLEKRLVVAHELHSP
EIKALAYGDLGHVHAALGNHAQALNCLEHQRELAQGLQDRALESDAMCALGQVQQRMGQH
AQALELHRQDLEICTELSAPALQARALSNLGSVHESLGQQAEALKCYERQLELSTDRLAK
AMACLALGRVHHQLEQHNQAVDYLRQGLASAQTTGKSEEEAKIRHQLGLALRSSGDAEGA
HIQLETAAQLLESVRHEQRSPETRQALYDLQTTCYQLLQVLLVALNRNEDALVAAERCKA
RGGADAVSGEGSKVPLADSESIQETVDRGRTTVLYYSLAGDQLFTWLLEPHVGIVRFHAA
KIDAHSLQLPLSLSEEEEEEEDLEMERELKLNRDQNQDQSEDQGTSNKANRLLERYMSLV
RDNLGVNSQSLLHEGDGSGWRASTEQLLEDLPGAGGSGGGGFLRMVSRNQLLNSSNYSLS
SLFSVGSVGGSVASLQGSTRSVGSRSSRRAPGLPVWRGPSCLHILYNLLLAPFDDLLPAG
EADTNRQGRRELVLVLDSSLYLVPFAILRAAQEDGEYLCERCAILTAPSLQSMRSRPRIR
RDRARPPKALVVGGPRIPSNLAELWGWAGAESPAALQEAAMVADMLQATALAGSNATKES
VLAELPSAECVHFAANISWQLGAVVLSPGDVVTAEQQEQKEPHEPQMTDFTLAAGELRQL
RLSARLVVLSSYHSVEPITGDGVAQLAGGWLLAGAGVVLISLWPVPETAAKILLRAFYSA
LLQGARAARALAEAMQTVQHTKHFAHPANWAGFLLVGSNIRLSNKVAMGHALCELLRTPE
RCRDALRVCLHLVEKSLQRIHRGQKNAMYTTQQSIENKAGPVAGWKDLLMAVGFRVEPAA
NGIPASVFFPQADPEERLAQCSASLQALLALTPATLQALGKLVHVNSAEYAGDIIAVVRN
ILAQFPGSNPATGSSSTKSDAIAETCFIEMPLSVRLWRVAGCHELLASVGFDLTEVGADQ
VILRTGKQANRRQCQFVLQALLALFDTREAPKNLGLDRDSDHSSSCESLAEPEMDVASIP
PAASSTPSVNGGNKAPLPLHPRSAFISYVRRRGEPDGGRTDAIGGVGSGALDSSLANTTD
SEHSLSDGYVTQPGFGLSNPRLGYASMRAPVRVSRPGGGGESDAAFTPSPPVTDPSLSLA
LAHQTRIRSLYSQTSSAAIVPPVATTLNRRPDSSSSASSTTDWEGSGHATVLRRGVSTAI
PQQQPPLPPPRPPTFHNLSVGAGGRSKPKIKLGSAQSSLAARVNKEHALFMDRLSVRTEL
SAPGSGNAMTSGSAARKPLALPEEEDVSNVVFNPSSLYFSQTDSDLLNEPKQEETPPPTK
SSTKSLQDSMMRHMNRELTPSISEMYHDRNVGLGLAPPLSKLLLSPNYEEQEVVSITEAC
PQSGANLKTLVDAVSELELSGSSSGATMPTVVGGGANEVEGTSGTSAEATCPICGEPADV
ICRCKAVTIQKKSILKPWLSNVPDSSLVQASELTTADILERRLEIHTATSSELRSGAPYS
VDLSRRDEGDGRSVADSQCSSNYKRVLASASGGALSLAGIGKGSEAEAQSASSGATCSSA
RLV
Download sequence
Identical sequences Q9VSK6
NP_001246673.1.81976 NP_648228.2.81976 FBpp0296980 FBpp0300832 FBpp0296980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]