SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0300988 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0300988
Domain Number 1 Region: 50-153
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.6e-37
Family Cold shock DNA-binding domain-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0300988   Gene: FBgn0003714   Transcript: FBtr0308831
Sequence length 154
Comment pep:known chromosome:BDGP5:X:2336346:2338009:-1 gene:FBgn0003714 transcript:FBtr0308831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIMIAISNLEQLILLYWFSLSDISNSFTSLPAIQCSYETAVRGMASLQQMHRSGPHIKTR
PPRQPLDGKPFAKGVVLKTLIKKPKKPNSANRKCVLVRLSTGKEMVAYIPGIGHNLQEHN
IVLCRVGRLQDVPGVKLKAVRGVYDLAHVVKKSQ
Download sequence
Identical sequences D3DMP8
FBpp0300988 NP_001245490.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]