SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0301760 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0301760
Domain Number - Region: 18-46
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0412
Family CCCH zinc finger 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0301760   Gene: FBgn0261642   Transcript: FBtr0310059
Sequence length 583
Comment pep:known chromosome:BDGP5:2R:13153023:13266881:1 gene:FBgn0261642 transcript:FBtr0310059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANVVNMNSLLNGKDSRWLQLEVCREFQRNKCSRQDTECKFAHPPANVEVQNGKVTACYD
SIKGRCNRDKPPCKYFHPPQHLKDQLLINGRNHLALKNALMQQMGIAPGQPVISGQVPAV
ATNPYLTGIPANSYSPYYTTGHLVPALLGPDPVTSQLGPVVPQTVQVAQQKIPRSDRLEQ
FSGMVPFKRPAAEKSGIPVYQPGATAYQQLMQPYVPVSSSPKIPLNASCVIYTDASGQLL
DTLPVCQDFNRSMCSRLNCRFVHLTEDDKVEVIDQRVAVCRDHANSQCRRKQCKYYHIPI
VLPPANIMAAMITSPSDQQPAVPVATTTANPAAAAAAAAAATAAGYNGTSNLIIIEPQQQ
QQQPPQQQQQFSYHSNSSNNNYYHSNASKQAAHASNMYQQQQQQHQQQQQHQQHLQHQQH
AQQQTHITYHCSSPYSPSSASSSSSCSIATSPTLSSATTLSTTSTATMPTPQQQYQGPAA
TATFLKAPAYYTDATPTLVLSSDYNSNCIPIQATPFISLQAAPQQHLLKYTTQAPPPQAQ
QHAFVGHHYQTQMGQVVATTVAAIPATTITVAPATVASPSTCI
Download sequence
Identical sequences A0A0B4KF98
FBpp0301760 NP_001261043.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]