SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0302021 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0302021
Domain Number 1 Region: 442-657
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.89e-49
Family DBL homology domain (DH-domain) 0.00042
Further Details:      
 
Domain Number 2 Region: 682-755,879-929
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000063
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 3 Region: 1084-1285
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000385
Family Quinoprotein alcohol dehydrogenase-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0302021   Gene: FBgn0263706   Transcript: FBtr0310338
Sequence length 1736
Comment pep:known chromosome:BDGP5:X:17350590:17425487:-1 gene:FBgn0263706 transcript:FBtr0310338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFQLIKSALDGPPQQQQQQQLLRRHSNLGLPHQHAAGVVLLKYEHKLNSGSWEDTLDEP
HHHHAHHSHHQQHLHQHHSHLSQRHQQQQQQQQQLQQTSFIGSPPSSASITTAQLHSAFS
RRIAEQRERDQRDQRDQREAVGCTAATIAGGSFSANGGQAAVGVGVGSSSSCGSSSERDT
KSPCRERDRNLERDRDRERDKNDDLGEEEVLTEEEQTSSSVSSLSAGNQRNSQLRSTFNK
AKQHLSFDKWRTAATGSATGSASGPGSSATDSNNAASNMIMRRASACTMPSSGGGGGAGV
GSSQREEATTPGESPGGRLSRWFSIRRGSSHQYDVGGRDGRHSTASSFDTPDSGSGNSPK
NGSNAVAGTGGAGSQGVALDAASPQKLANLGASKMMPGVPESEDDEATANRFDVDLMMTP
GSRANGTARTAHNRLIVPMLPPAPAGLSQQQLKRRHIVAAIVHSENSYVATLQRLVNDYK
KPLEECSPPVLNPVKIATLFHCLPDILHSHKLFRISLAECVRNWDRDEKIGDCFVSAFGK
PQLLEIYSGFINNFSAAMELAKMEEKRKSALADFFKVKQISAHDRLSFFGLMVKPVQRFP
QFILFLQDLLKYTPQGHHDRMSLQLALSQLELLAELLNESKREAEQYQAFKEMLGHISGT
FNARSLSLSSVSVSDSAGGHRPRYLLREDNVTHMEFNQAGFIVKCKQRRLLLLNDKVICV
SVAPKQSHDFGATEKLTFKWMFPVNDVEIVDNSTSATLSRILTAGLNRGGSLKSNGSSGA
NGSPYANSTLPGHGGGVSGFSGFGDPHSSPAAQLTNGADNLCSEMSTLMYDYEVISRIQD
LVSSLKGSYKELNANTTRNVLNLIQGSIQRKDEEMAWVDSCCLQLIGRHKSGKEETFTFQ
TQTPAVKKEWITELRLAQLALDPNNSPAWERGGSHPQPAHHHPHHHPLQHPHAGAGDPRQ
TQEQLQLQEAVQQKQSRKMPLFVKAMPVYKSQHQTEVRCGCYYSIANDTKQSGNARRRHK
QLNYLWMCSSDGTSSHITVLAQHPQQAGNLREAGAFDLFETQVSALEFVKGLDQLKSRDE
PASLLGDLVWLGTDSRKILIYSARNPEQEEQLGSYSVPGAVQRILYHFDAVYVALSGATV
LIFRRGNDGVWQLRDPQTIRLGDTDLVVPSLLPINMCIYASCGNRVYVMNALNGEIQRSF
EVQHGATQQVNLMAHSGIGLWISLKNSTMLCLYHTETFKHLQDINIASSVLRHDGKKEQP
LNNSSVYVTALMACKGLLWVGTNVGIAVTIPLPRLEGVPIISGGINMSCHAHFGPITFLL
PLIPKVYPAYKPPTVGAAPLVPSMGDDLQLPAIDADPKIQELDDGAVVLRRDLAKEEMSS
SNPGADSTASSPRSSKLDKQNSLDQSFTAKIRASLANSPAFHRKRFRDDPNRMSKTLPRG
LGAAAAGSGAGGASAAGSGTASGNTSQHGEHGICDVYGLYGKLIFVKEDYDAEEGNQGNL
MDMMYEGMRRSDPELAAIPGKVCTLDRRLRMKASRPRSLDLSNWSVDSKSSSLYTSSGSE
ESMGIRHFGGRSVSRNSSSASHKTSGTGSDLGNISENGLMTTADIHHHQQQQQQLNSSAK
PDEMSRLGAGNSGLDKPAAAVATLKRKQKQNSKQQQQQNADGPRTVITLMGGRGYWRQMW
YNGAGGSPSHKNSSSGGGGGSGSGFSGQTMQSGNPSCSPLTANSNDAHIVVWEKKL
Download sequence
Identical sequences E1JJN5
NP_001162780.2.81976 FBpp0302021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]