SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0302677 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0302677
Domain Number 1 Region: 232-298
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.13e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 2 Region: 120-191
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000555
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 3 Region: 576-623
Classification Level Classification E-value
Superfamily RING/U-box 0.00000022
Family RING finger domain, C3HC4 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0302677   Gene: FBgn0039920   Transcript: FBtr0310540
Sequence length 628
Comment pep:known chromosome:BDGP5:4:700896:708191:1 gene:FBgn0039920 transcript:FBtr0310540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQVTPKISTCINSKGSIQKKNQAQHHDMSEQSKVNESTLPLSDDPRTLQLALELSLVG
FNDNQNCYAQPAQPLPMPLSARSDFEIGTINSTLPIPSAPNCLLLPNAGAVSSEDRSKKS
QNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVNKA
KREILSAADHFSLIRASRKPVSDSQNNGMVGSTTSSGGGAVPRMSGPPCMPGQVTIQVRV
PYRVVGLVVGPKGATIKHIQQETQTYIVTPSREKEPIFEVTGLPDNVDTARKQIEAHIAL
RTGSGSGSGDAITMQSSDSVDTKEYASLPSLTQILNDDLNSEILSSIYKNSVPSTQEYAN
NSMKTVVNVSNSVKLVQGHHTGNCFQKSEFAEMEMTANITAADILDKRLPGNEVSVPLAK
ANVANIVFRTTSSKTLSFCPPTSTSASFHSNCNANILTRSCSSASSTTSTKSTNNSANTP
PEILNIWKSISDSIDVDEGIGDSPSIWNQPANIIPTAHCSPTISISPTDSLLGMGEHSAN
QQNLNHAKEPIMPNLPQKIKGIQVQSNADNFLTHRECFVCNENTVTTALVPCGHNMFCME
CANHICLSMDAVCPVCNSIVYHAMRILG
Download sequence
Identical sequences Q9V4F3
FBpp0088160 FBpp0302676 FBpp0302677 FBpp0302678 NP_001259068.1.81976 NP_001259069.1.81976 NP_001259070.1.81976 NP_651934.2.81976 FBpp0088160 FBpp0088160 7227.FBpp0088160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]