SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303050 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303050
Domain Number 1 Region: 286-520
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.26e-19
Family FCH domain 0.035
Further Details:      
 
Domain Number 2 Region: 699-756
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000142
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303050   Gene: FBgn0263980   Transcript: FBtr0330015
Sequence length 1132
Comment pep:known chromosome:BDGP5:2R:11288601:11349063:1 gene:FBgn0263980 transcript:FBtr0330015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGISAHAAPASFWNHPRRIRRTPTSDRDGVDQCRPWICRRKDRRPAHPAANRPPESRVCG
PSSTFRWDDWAAPAPRTRERATDCARMCMCTSRIPYSVARICARTTSMHSSRPASRSSSF
IRRPLTRRQRMAVGGVTRRLWRTMRVYTIHQGRGVRRARAAQAVAAYLRDRRARIGKGWP
AQGHGVRISATEQWADKPVVRRPGDPTRRVAAGAVPVLAERLPKVTGSSVKSSSGRRSRR
RRIFGWRGPRGGSLSPQGGSMASYNGVLKDYSHSSLNEAFKSQNNVNFKLIKTVSDFSET
LSRLYEEHATALQVAVSNYRKKNAELRKERPACHLAIFQAWETFLQEVETDSQACNDVAS
VLSRQVSRPMLDKSFHRKVQSRKIFTHRESFETIIAKTEEKLSKCRVDYKQCHLAHRQNP
SQHSLTEYIDAHNAYVQQLHATNGMLEAYHTDTLPQQMQELEEIHNDLVAIVSDSLMQGA
EVIAGKANDQAKRYNSLSNQCAAVSPQQDLVNFVRLLAQPSQAQKIPRRLFASPQAEVGE
EAGDHNEMTPCLRNELVFDRHSTLSQRSALESLKREAIELELQIRQLQDSIEALNRTQTR
GIEGQLYNKVNELQEDLSMKKFDLRAKQIHLAAIRAQKDLFVSKVEPTSPRNERKFSAAT
APSMKTKWLKAFKSLKPAGSGSAQQADRRNGASSTASEPLRPNLDGSHHLQEYTYKKITA
CDVCSQILRGHTRQGLRCRICKLNAHGDCAPNLPRCQPKQKLLRRQKSTSELENRVDIEE
ETGADKSVQAKQMDGSVAGGSALPVPVLSERELGRAPPPDIPIVSVSELALQEQQQQQQQ
QQQQHQQQQRSLASVAQAAAVRAGRGVRPPPVAMPILGVQLQQQELQQQRGGLPVPSQDI
SSSSEPRYGQFFAPVSNMSSSAYISNGIGINYYTGNTQQVAYMQQVPATSSSISAGTSPA
HQQQQQQQPQQCGGSTSGSSINYSTTDPGLRRRLFAGIRPLSVFGRLRQQRSSQHRSISL
PESNYDTLENMRGSGDSNNHNRPLHNDTSNNHVMPMQKSFHLPASTSSTTTTTTTTATTP
LTSYFGDAYNSIIDPIIAMSSRWNSTAFDSHSTSMFRLCYRVLCIFFNLFPV
Download sequence
Identical sequences FBpp0303050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]