SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303431 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303431
Domain Number 1 Region: 531-894
Classification Level Classification E-value
Superfamily Arginase/deacetylase 7.19e-113
Family Histone deacetylase, HDAC 0.000000573
Further Details:      
 
Domain Number 2 Region: 103-461
Classification Level Classification E-value
Superfamily Arginase/deacetylase 1.01e-104
Family Histone deacetylase, HDAC 0.00000202
Further Details:      
 
Domain Number 3 Region: 983-1079
Classification Level Classification E-value
Superfamily RING/U-box 6.57e-26
Family Zf-UBP 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303431   Gene: FBgn0026428   Transcript: FBtr0330405
Sequence length 1179
Comment pep:known chromosome:BDGP5:X:15227343:15234393:1 gene:FBgn0026428 transcript:FBtr0330405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPPIVTRRSAQQAKIQTRAMASKSKTGTTGAATAAGGTGSSSGSISGGFNAADPRKSNK
PNAALLEAKRRARNNMLKNQGCGSQESVTDIFQNAVNSKSLVRKPTALIYDESMSQHCCL
WDKEHYECPERFTRVLERCRELNLTERCLELPSRSATKDEILRLHTEEHFERLKETSGIR
DDERMEELSSRYDSIYIHPSTFELSLLASGSTIELVDHLVAGKAQNGMAIIRPPGHHAMK
AEYNGYCFFNNVALATQHALDVHKLQRILIIDYDVHHGQGTQRFFYNDPRVVYFSIHRFE
HGSFWPHLHESDYHAIGSGAGTGYNFNVPLNATGMTNGDYLAIFQQLLLPVALEFQPELI
IVSAGYDAALGCPEGEMEVTPACYPHLLNPLLRLADARVAVVLEGGYCLDSLAEGAALTL
RSLLGDPCPPLVETVPLPRAELAQALLSCIAVHRPHWRCLQLQQTYDCVELQDRDKEEDL
HTVLRHWIGGPPPMDRYPTRDTAIPLPPEKLTSNAARLQVLRAETKLSVPSFKVCYAYDA
QMLLHCNLNDTGHPEQPSRIQHIHKMHDDYGLLKQMKQLSPRAATTDEVCLAHTRAHVNT
VRRLLGREPKELHDAAGIYNSVYLHPRTFDCATLAAGLVLQAVDSVLRGESRSGICNVRP
PGHHAEQDHPHGFCIFNNVAIAAQYAIRDFGLERVLIVDWDVHHGNGTQHIFESNPKVLY
ISLHRYEHGSFFPKGPDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAFQQLIMPIAY
EFNPQLVLVSAGFDAAIGDPLGGCKVTAEGYGMLTHWLSALASGRIIVCLEGGYNVNSIS
YAMTMCTKTLLGDPVPTPQLGATALQKPPTVAFQSCVESLQQCLQVQRNHWRSLEFVGRR
LPRDPVVGENNNEDFLTASLRHLNISNDDATAAAGGLAGDRPDCGDERPSGSKPKVKVKT
LSDYLAENKEALEQSEMFAVYPLKTCPHLRLLRPEEAPRSLDSGAECSVCGSTGENWVCL
SCRHVACGRYVNAHMEQHSVEEQHPLAMSTADLSVWCYACSAYVDHPRLYAYLNPLHEDK
FQEPMAWTHGCAWREDGCYATGPDGRDEDDDDDNGAGSSICLRLERNNXPLAIRVLDALT
DYLCALCPPLRHLIHFLAEHLWPLLERIYLNLLHYFLAH
Download sequence
Identical sequences M9PJN5
NP_001259569.1.81976 FBpp0303431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]