SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303600 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303600
Domain Number 1 Region: 7-75
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000148
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 2 Region: 416-448
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000549
Family CCCH zinc finger 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303600   Gene: FBgn0036621   Transcript: FBtr0331173
Sequence length 819
Comment pep:known chromosome:BDGP5:3L:16366316:16371750:-1 gene:FBgn0036621 transcript:FBtr0331173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPIQAPSWTDFLNCPICCNEFAASQRCPVSLGCGHTICKLCLTTLYNRQCPFDQTVIVSD
IDNLPINHALLQLVKDSELLELAPPPPSVQKLEPEHLKCYQLGQRCIEELALHLKSFLNL
NGNGNLLTRPMLRKLVTLVNCQLMEEEGRVRALRAARSLGERTVTELILQHQNPQQLSSN
LWAAVRTRGCQFLGPAMQEEVLKLVLLALEEGSALSRKVLVMFVVQRLEPKFPQASKTSI
GHVVQLLYRASCFKVSKREADSSLMQLKEEFRTYDALRREHDAQIVQIATEAGLRIAPEQ
WSSLLYGDVMHKSHMQSIIDKLQTPSSFAQSVQELVIALQRTSDPAKLSSLHHHLKYLAN
IDPCAEVAPWSVLAEALDAVRHSVVGLVNFLQHHGVRKAQDGISGGGSGGTTNSNPKYKI
SLCRDLNVRRVCPRGSSCTFAHSQEEVERYRARNRGKHMKTPLALQGPPAVGVGAIKKPL
GEQEGPPLGNMPPMLPMSPMHYMGSPRGYLDPSLGLSPGGGLPPSHHSPITRLIVPSRYD
SRFSGFGGGTPRIPSPREYQANPVAPTQRNANPPNFSVNSNLHKGYMLPASGGDVFHLAN
PWEQAYLAQQQHPPQHPQQQQPPSSKPNPSRPLSILPATADTSFFEKKPPNSVSIDLDRV
PEVNVDAVPLFRRSNNNHNNNNSNSHNNNNNNHGSSLLFWNNTGKDSANFVRSDSILDDD
ASTFDVPTGSSMLSIYGPICPKSSTTGNWNNFDLGYGGFKSDRNDSFNANKQQQPMWGRK
PQLMSEDSFEGGIDSGMMLQLEKNLVDIVDPDDSGIKVD
Download sequence
Identical sequences Q9VV48
FBpp0075181 FBpp0303600 FBpp0305463 FBpp0075181 NP_001261940.1.81976 NP_001261941.1.81976 NP_648886.1.81976 7227.FBpp0075181 FBpp0075181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]