SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304872 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304872
Domain Number 1 Region: 3-205
Classification Level Classification E-value
Superfamily Kelch motif 1.7e-42
Family Kelch motif 0.0011
Further Details:      
 
Domain Number 2 Region: 155-311
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 4.58e-28
Family Galactose oxidase, central domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304872   Gene: FBgn0030053   Transcript: FBtr0332626
Sequence length 403
Comment pep:known chromosome:BDGP5:X:8482844:8484807:1 gene:FBgn0030053 transcript:FBtr0332626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWTVHLDGGPQRVNHAAVGVGDFIYSFGGYCTGYDYRYNEPIDVHALNAHTMRWTLVPQ
QLDDAGVPLKYPLVPFQRYGHTVVAYKDRIYIWGGRNDENLCNTLYCFDPKTAQWSRPQV
TGCLPGARDGHSACVIGNSMYIFGGFVDEINEFSSDVHSLNLDTMEWRYVQTFGVPPSYR
DFHASVAYEQERMYIFGGRGDKHSPYHSQEETYCHEIVYLDMKTKVWHRPFTAGKVPVGR
RSHSMFVYNKLIYVFGGYNGLLDQHFNDLYTFDPRTKLWNLIRANGKAPTARRRQCAIVM
GTRMFLFGGTSPRSGSSSSPAAVSPTQETGGAAAAGGVVPPGVALIDYSDLHVLDFEPTL
KTLATMVVLKHQLDISGLPRSFRSDLQMLTQPNSISRPINQAG
Download sequence
Identical sequences Q9W3D5
FBpp0071164 FBpp0304872 FBpp0071164 NP_001259343.1.81976 NP_572494.1.81976 7227.FBpp0071164 FBpp0071164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]