SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305215 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305215
Domain Number 1 Region: 242-375
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 4.05e-16
Family Toll/Interleukin receptor TIR domain 0.0058
Further Details:      
 
Domain Number 2 Region: 83-173
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000206
Family DEATH domain, DD 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305215   Gene: FBgn0033402   Transcript: FBtr0333000
Sequence length 537
Comment pep:known chromosome:BDGP5:2R:5190328:5196227:-1 gene:FBgn0033402 transcript:FBtr0333000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPRFVCHQQHSVAHSHYQPHSHFHHHTHRHPNPPHHHHIYGATDVSYRRYRTAGMVVAE
GVMDSGSGSGTGTGLGHFNETPLSALGIETRTQLSRMLNRKKVLRSEEGYQRDWRGISEL
AKQKGFVDENANNPMDLVLISWSQRSPQTAKVGHLEHFLGIIDRWDVCDDIQENLAKDTQ
RFIMKQEQRQTALVEACPPPPSDCFETNNNYSSSNNITVGQSVQILSDEDQRCVQMGQPL
PRYNACVLYAEADIDHATEIMNNLESERYNLRLFLRHRDMLMGVPFEHVQLSHFMATRCN
HLIVVLTEEFLRSPENTYLVNFTQKIQIENHTRKIIPILYKTDMHIPQTLGIYTHIKYAG
DSKLFNFWDKLARSLHDLDAFSIYSTRQVQTPSPVEESAPRVTTPSIRIQINDKDVTDMP
NYNSCKVPEAETTIVSVSGDTGSPLPEHKPKKKDRFLRRITHSFGKTARSDGASGKTLRH
AHSVSTINVTERERTLSASSSNISTTSESKKSFIKWQPNILKKALFSRSSSKLQTPG
Download sequence
Identical sequences Q7K105
7227.FBpp0087679 NP_001260821.1.81976 NP_001286246.1.81976 NP_610479.1.81976 FBpp0087679 FBpp0305215 FBpp0087679 FBpp0087679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]