SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305236 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305236
Domain Number 1 Region: 107-161
Classification Level Classification E-value
Superfamily RING/U-box 3.3e-16
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305236   Gene: FBgn0036421   Transcript: FBtr0333022
Sequence length 176
Comment pep:known chromosome:BDGP5:3L:14362025:14362807:-1 gene:FBgn0036421 transcript:FBtr0333022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSNSSESLNKMKSLVGKMIFMQVTEHLFLRAQQLLDSDVSIEERVRRMEVLNNNMKWFN
SERTRILEQLQLNIFGQISVEHHNAMNMSENLYELREGLDGLSRRMESMQEDITCSICLS
PWSSNGRHRVVSLRCGHLFGNSCIRTAIRRSHRCPICRRRALHADVRRIFSRRISH
Download sequence
Identical sequences Q9VUE3
FBpp0112083 7227.FBpp0112083 FBpp0112083 FBpp0305236 FBpp0112083 NP_001097605.1.81976 NP_001261837.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]