SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305559 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305559
Domain Number 1 Region: 129-228
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 2.32e-34
Family Anticodon-binding domain of Class II aaRS 0.00014
Further Details:      
 
Domain Number 2 Region: 15-88
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000271
Family Canonical RBD 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305559   Gene: FBgn0024542   Transcript: FBtr0333367
Sequence length 371
Comment pep:known chromosome:BDGP5:3L:7234917:7236239:1 gene:FBgn0024542 transcript:FBtr0333367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDPGSAGYNITKDPALAKSRIFLGNLPVCTREELVSICQPYGKVLGSMVQKNYGFVQFE
TEELANKAASALHKSTFKQNMLTVRNASIKSKAANAIAKRNSNQGGQVTVQGGLVMSAAA
AAAGQPLINDCEIIVQNRENTKYAEYIEERLKNSSLRVDVLFPNEDVLLGKVLANISSRG
CLYAVLVTPQHEEHNSITVNILYGVPAEHRNMPLEDAITLISTDFRLKKQRDAVVLPPST
SIHKGQRRHPQEMQGLLERLADNHPLTASQYEVILKYLEGEREEQLKREVGEANALAKLK
APDPEIELQKKILSIMNKPAVTDVTSELMYPTFEAVKEDRRLMELLADDRVLAALESVYN
SDLRQILAEYL
Download sequence
Identical sequences Q9U9Q2
FBpp0076546 FBpp0076546 FBpp0076546 FBpp0305559 NP_001261502.1.81976 NP_523955.1.81976 7227.FBpp0076546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]