SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305602 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305602
Domain Number 1 Region: 482-573,626-829
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 5.63e-42
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.073
Further Details:      
 
Domain Number 2 Region: 94-203
Classification Level Classification E-value
Superfamily TPR-like 4.36e-20
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 
Weak hits

Sequence:  FBpp0305602
Domain Number - Region: 5-132
Classification Level Classification E-value
Superfamily TPR-like 0.000632
Family Tetratricopeptide repeat (TPR) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305602   Gene: FBgn0260749   Transcript: FBtr0333410
Sequence length 934
Comment pep:known chromosome:BDGP5:2L:10272627:10277161:-1 gene:FBgn0260749 transcript:FBtr0333410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKHCGEFHIALKHLQLALLYTYPSTFSELQVKFQIAHLYEVQNKHKAAKDGYEFLLNEK
NISLELKADVYRQLGWMYHCVECLGEKKEREANALNFLQKSIEADPKSGQSLYLLGRCYA
GINKVHDAFLAYRNSVEKSEGNADTWCSIGVLYQQQNQPTDALQAYICAVQLDKDHKAAW
TNLGILYESCGQLRDAYACYLNATKQISFQKSSLIRKKQAIRMKKDTIGLSKGLSQRITF
LEGQLSQAPLPSITSKRRQLCSIEEAWNLPISLEMNSRQQQTAQMLPRQVTKQSPVQGPP
PPYPHSQLSQSPIPSKRIKEDGTSQQEVTQNNSQTSAQNLINISESLNQRNFNAMPESNK
SSEQSVLDTFDDISNDIYKQNESIKLERLSQDALSNNEDSRHDFIGGDNADISTTFKIQM
DSKQLMVAVKLLPIDEPPVHCTILQVNAPPPSPPDCPPQKLTRDQLLPPTPSVHLENKKH
AFSPQLQEFCLKHPIAVVRGLAGVLKLDLGLFSTKTLVEANPDHSVEVRTQVHQSPDENW
DTSQGKRVWACISHRSHTTIAKYAQYQASSFQDSLKDESDKGFPGSQAMSDSDSKDSVSN
SNIVLKRKKHKINSKMLRFGTNVDLSDEKKWKPQLTELQKLPAFARVISAANMLSHVGHV
ILGMNTVQLYMKVPGSRTPGHQENNNFCSININIGPGDCEWFAVPDAYWGGVHNLCEKNN
ISYLHGSWWPVLEDLYKENIPVYRFIQKPGDLVWVNAGCVHWVQSIGWCNNIAWNVGPLT
ARQYSLAIERYEWNKVQAFKSIVPMVHLSWNLARNIKVSDTKLFELIKMCLLQTLKNVLH
IQEYVKSKGVEIRFNGRGKNEASHYCGQCEVEVFNVLFIKEQEKRHVVHCLSCALKLSPS
LQGIVCLEEYRLSELQRVYDSFTLHRTQGLAYTQ
Download sequence
Identical sequences M9PCJ7
FBpp0305602 NP_001260319.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]