SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0070086 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070086
Domain Number 1 Region: 148-316
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.55e-38
Family Canonical RBD 0.0000669
Further Details:      
 
Domain Number 2 Region: 400-481
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.13e-26
Family Canonical RBD 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070086   Gene: FBgn0260400   Transcript: FBtr0070091
Sequence length 483
Comment pep:known chromosome:BDGP5:X:411269:417259:-1 gene:FBgn0260400 transcript:FBtr0070091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFIMANTGAGGGVDTQAQLMQSAAAAAAVAATNAAAAPVQNAAAVAAAAQLQQQQVQQA
ILQVQQQQTQQAVAAAAAAVTQQLQQQQQAVVAQQAVVQQQQQQAAAVVQQAAVQQAVVP
QPQQAQPNTNGNAGSGSQNGSNGSTETRTNLIVNYLPQTMTEDEIRSLFSSVGEIESVKL
IRDKSQVYIDPLNPQAPSKGQSLGYGFVNYVRPQDAEQAVNVLNGLRLQNKTIKVSFARP
SSDAIKGANLYVSGLPKTMTQQELEAIFAPFGAIITSRILQNAGNDTQTKGVGFIRFDKR
EEATRAIIALNGTTPSSCTDPIVVKFSNTPGSTSKIIQPQLPAFLNPQLVRRIGGAMHTP
VNKGLARFSPMAGDMLDVMLPNGLGAAAAAATTLASGPGGAYPIFIYNLAPETEEAALWQ
LFGPFGAVQSVKIVKDPTTNQCKGYGFVSMTNYDEAAMAIRALNGYTMGNRVLQVSFKTN
KAK
Download sequence
Identical sequences M9NFP7 P16914
FBpp0070086 FBpp0070086 NP_001245447.1.81976 NP_525033.1.81976 XP_016037541.1.80810 7227.FBpp0070086 FBpp0070086 FBpp0298002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]